Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-pasA/RelE-HTH
Location 23208..23682 Replicon plasmid paNv_UK3
Accession NZ_CP123564
Organism Arsenophonus nasoniae strain aNv_UK

Toxin (Protein)


Gene name relE Uniprot ID A0A4P7L6N8
Locus tag QE193_RS21785 Protein ID WP_026823134.1
Coordinates 23416..23682 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A4P7L1P3
Locus tag QE193_RS21780 Protein ID WP_026823135.1
Coordinates 23208..23432 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE193_RS21755 (QE193_21765) 18615..19559 - 945 WP_135679022.1 replication initiator protein A -
QE193_RS21760 (QE193_21770) 20372..20683 + 312 WP_167876782.1 colicin E1 family microcin immunity protein -
QE193_RS21765 (QE193_21775) 20713..21996 - 1284 WP_051297045.1 colicin-like pore-forming protein -
QE193_RS21770 (QE193_21780) 22407..22682 - 276 WP_026823137.1 response regulator transcription factor -
QE193_RS21775 (QE193_21785) 22679..22861 - 183 WP_026823136.1 hypothetical protein -
QE193_RS21780 (QE193_21790) 23208..23432 + 225 WP_026823135.1 DUF6290 family protein Antitoxin
QE193_RS21785 (QE193_21795) 23416..23682 + 267 WP_026823134.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE193_RS21790 (QE193_21800) 23803..24420 - 618 WP_081700663.1 plasmid partitioning/stability family protein -
QE193_RS21795 (QE193_21805) 24425..25408 - 984 WP_026823133.1 plasmid segregation protein ParM -
QE193_RS21800 (QE193_21810) 26060..26518 + 459 WP_248604879.1 hypothetical protein -
QE193_RS21805 (QE193_21815) 26528..27463 + 936 WP_246067601.1 IS91 family transposase -
QE193_RS21810 (QE193_21820) 27521..28525 + 1005 WP_280622596.1 IS21 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..135571 135571


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Relaxosome protein TraY

(4-44)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10406.12 Da        Isoelectric Point: 9.3777

>T279043 WP_026823134.1 NZ_CP123564:23416-23682 [Arsenophonus nasoniae]
MVWKIKYADSALKSLKKMDRQNAKRIVDYLDKRIASSDDPRIFGKSLKGDLGEFWRYRIGDYRVICEILDEELIILAAII
GHRREVYE

Download         Length: 267 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8474.56 Da        Isoelectric Point: 5.6993

>AT279043 WP_026823135.1 NZ_CP123564:23208-23432 [Arsenophonus nasoniae]
MLAIRLPDEIENRLDNLAKRTGRTKTFYAREAILTHLEDLEDYYLAASVVARVRKGQDTVHSSEDVRKSLGLED

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L6N8

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7L1P3

References