Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 197077..197611 | Replicon | plasmid paNv_UK1 |
| Accession | NZ_CP123562 | ||
| Organism | Arsenophonus nasoniae strain aNv_UK | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QE193_RS20555 | Protein ID | WP_135678429.1 |
| Coordinates | 197330..197611 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QE193_RS20550 | Protein ID | WP_135678431.1 |
| Coordinates | 197077..197343 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE193_RS20525 (QE193_20535) | 192132..193100 | - | 969 | WP_135678441.1 | DUF2184 domain-containing protein | - |
| QE193_RS20530 (QE193_20540) | 193104..193541 | - | 438 | WP_246067492.1 | hypothetical protein | - |
| QE193_RS20535 (QE193_20545) | 193583..194770 | - | 1188 | WP_135678437.1 | DUF2213 domain-containing protein | - |
| QE193_RS20540 (QE193_20550) | 194757..195635 | - | 879 | WP_167876731.1 | phage minor head protein | - |
| QE193_RS20545 (QE193_20555) | 195592..196779 | - | 1188 | WP_280622536.1 | DUF1073 domain-containing protein | - |
| QE193_RS20550 (QE193_20560) | 197077..197343 | + | 267 | WP_135678431.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QE193_RS20555 (QE193_20565) | 197330..197611 | + | 282 | WP_135678429.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| QE193_RS20560 (QE193_20570) | 197699..198304 | - | 606 | WP_135678426.1 | recombinase family protein | - |
| QE193_RS20565 (QE193_20575) | 198505..198768 | - | 264 | WP_246067491.1 | hypothetical protein | - |
| QE193_RS20570 (QE193_20580) | 199320..200210 | - | 891 | WP_246067489.1 | transposase | - |
| QE193_RS20575 (QE193_20585) | 200321..200932 | + | 612 | Protein_262 | IS21 family transposase | - |
| QE193_RS20580 (QE193_20590) | 200997..202155 | - | 1159 | Protein_263 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..220475 | 220475 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10884.58 Da Isoelectric Point: 10.4639
>T279042 WP_135678429.1 NZ_CP123562:197330-197611 [Arsenophonus nasoniae]
MRTIERSVTFKRDYKREAKGRHRNNLDKVLISVITSLVIDEPLKTSHRDHDLIGKWSGHRECHIKPDLLLIYRKPDSETL
QLVRLGSHAQLFG
MRTIERSVTFKRDYKREAKGRHRNNLDKVLISVITSLVIDEPLKTSHRDHDLIGKWSGHRECHIKPDLLLIYRKPDSETL
QLVRLGSHAQLFG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|