Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 36445..36980 Replicon plasmid paNv_UK1
Accession NZ_CP123562
Organism Arsenophonus nasoniae strain aNv_UK

Toxin (Protein)


Gene name relE Uniprot ID A0A4P7L9F7
Locus tag QE193_RS19450 Protein ID WP_026824095.1
Coordinates 36693..36980 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4V1BXI0
Locus tag QE193_RS19445 Protein ID WP_026824096.1
Coordinates 36445..36696 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE193_RS19415 (QE193_19420) 32338..33582 + 1245 WP_026823913.1 oligosaccharide flippase family protein -
QE193_RS19420 (QE193_19425) 33738..34196 - 459 WP_280622545.1 transposase -
QE193_RS19425 (QE193_19430) 34150..34434 - 285 WP_280622546.1 transposase -
QE193_RS19430 (QE193_19435) 34427..34942 - 516 WP_280622547.1 transposase zinc-binding domain-containing protein -
QE193_RS19435 (QE193_19440) 34952..35410 - 459 WP_210409124.1 hypothetical protein -
QE193_RS19440 (QE193_19445) 35470..36363 - 894 WP_081700726.1 type II secretion system F family protein -
QE193_RS19445 (QE193_19450) 36445..36696 + 252 WP_026824096.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QE193_RS19450 (QE193_19455) 36693..36980 + 288 WP_026824095.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE193_RS19455 (QE193_19460) 37447..38602 - 1156 Protein_38 IS3 family transposase -
QE193_RS19460 (QE193_19465) 38914..39528 + 615 WP_280622548.1 transposase zinc-binding domain-containing protein -
QE193_RS19465 (QE193_19470) 39441..39803 + 363 WP_280622549.1 transposase -
QE193_RS19470 (QE193_19475) 39894..40112 + 219 WP_280622550.1 hypothetical protein -
QE193_RS19475 (QE193_19480) 40237..40512 + 276 WP_026824203.1 hypothetical protein -
QE193_RS19480 (QE193_19485) 40583..40798 - 216 WP_026824204.1 cold-shock protein -
QE193_RS19485 (QE193_19490) 41013..41249 - 237 Protein_44 phosphate-starvation-inducible PsiE family protein -
QE193_RS19490 (QE193_19495) 41359..41484 + 126 WP_276489426.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..220475 220475


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11252.32 Da        Isoelectric Point: 10.9743

>T279041 WP_026824095.1 NZ_CP123562:36693-36980 [Arsenophonus nasoniae]
MIYKVKFRTDALKEWNNLDRSIQQQFARKLKKCAENPHIPAARLRGMQNCYKIKLRSSGFRLVYQIFKDELIIAVVAVGK
REHSEVYKLASKRLR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9362.58 Da        Isoelectric Point: 4.0543

>AT279041 WP_026824096.1 NZ_CP123562:36445-36696 [Arsenophonus nasoniae]
MPTTILSTTTASITELKTNPMATVNSGDGYPVAILNRNQPAFYCIPAELYEQMLEFIDDQELANLVKERAEQTLHDVNLD
RYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L9F7

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1BXI0

References