Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2881526..2882154 | Replicon | chromosome |
Accession | NZ_CP123561 | ||
Organism | Arsenophonus nasoniae strain aNv_UK |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D2TWD5 |
Locus tag | QE193_RS14970 | Protein ID | WP_026821483.1 |
Coordinates | 2881951..2882154 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A4P7KX12 |
Locus tag | QE193_RS14965 | Protein ID | WP_026821484.1 |
Coordinates | 2881526..2881894 (+) | Length | 123 a.a. |
Genomic Context
Location: 2876680..2877843 (1164 bp)
Type: Others
Protein ID: WP_026821486.1
Type: Others
Protein ID: WP_026821486.1
Location: 2877886..2881005 (3120 bp)
Type: Others
Protein ID: WP_026821485.1
Type: Others
Protein ID: WP_026821485.1
Location: 2881526..2881894 (369 bp)
Type: Antitoxin
Protein ID: WP_026821484.1
Type: Antitoxin
Protein ID: WP_026821484.1
Location: 2881951..2882154 (204 bp)
Type: Toxin
Protein ID: WP_026821483.1
Type: Toxin
Protein ID: WP_026821483.1
Location: 2882952..2884732 (1781 bp)
Type: Others
Protein ID: Protein_2916
Type: Others
Protein ID: Protein_2916
Location: 2884725..2886471 (1747 bp)
Type: Others
Protein ID: Protein_2917
Type: Others
Protein ID: Protein_2917
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE193_RS14955 (QE193_14960) | 2876680..2877843 | + | 1164 | WP_026821486.1 | efflux RND transporter periplasmic adaptor subunit | - |
QE193_RS14960 (QE193_14965) | 2877886..2881005 | + | 3120 | WP_026821485.1 | efflux RND transporter permease subunit | - |
QE193_RS14965 (QE193_14970) | 2881526..2881894 | + | 369 | WP_026821484.1 | Hha toxicity modulator TomB | Antitoxin |
QE193_RS14970 (QE193_14975) | 2881951..2882154 | + | 204 | WP_026821483.1 | HHA domain-containing protein | Toxin |
QE193_RS14980 (QE193_14985) | 2882952..2884732 | - | 1781 | Protein_2916 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
QE193_RS14985 (QE193_14990) | 2884725..2886471 | - | 1747 | Protein_2917 | SmdA family multidrug ABC transporter permease/ATP-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8133.45 Da Isoelectric Point: 6.9767
>T279040 WP_026821483.1 NZ_CP123561:2881951-2882154 [Arsenophonus nasoniae]
MTKIDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
MTKIDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14453.41 Da Isoelectric Point: 5.1197
>AT279040 WP_026821484.1 NZ_CP123561:2881526-2881894 [Arsenophonus nasoniae]
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLSEILTNDIKYSLSNT
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLSEILTNDIKYSLSNT
Download Length: 369 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | D2TWD5 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7KX12 |