Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2641405..2642059 | Replicon | chromosome |
| Accession | NZ_CP123561 | ||
| Organism | Arsenophonus nasoniae strain aNv_UK | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A4P7L3M1 |
| Locus tag | QE193_RS13735 | Protein ID | WP_026821813.1 |
| Coordinates | 2641405..2641812 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A4P7KWA0 |
| Locus tag | QE193_RS13740 | Protein ID | WP_026821812.1 |
| Coordinates | 2641793..2642059 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE193_RS13715 (QE193_13720) | 2637089..2637829 | + | 741 | WP_280622420.1 | transposase zinc-binding domain-containing protein | - |
| QE193_RS13720 (QE193_13725) | 2637876..2638286 | + | 411 | WP_280622421.1 | transposase | - |
| QE193_RS13725 (QE193_13730) | 2639071..2640384 | + | 1314 | WP_051296926.1 | S8 family serine peptidase | - |
| QE193_RS13730 (QE193_13735) | 2640871..2641389 | + | 519 | WP_026821814.1 | flavodoxin FldB | - |
| QE193_RS13735 (QE193_13740) | 2641405..2641812 | - | 408 | WP_026821813.1 | protein YgfX | Toxin |
| QE193_RS13740 (QE193_13745) | 2641793..2642059 | - | 267 | WP_026821812.1 | FAD assembly factor SdhE | Antitoxin |
| QE193_RS13745 (QE193_13750) | 2642319..2643305 | + | 987 | WP_051296925.1 | tRNA-modifying protein YgfZ | - |
| QE193_RS13750 (QE193_13755) | 2644160..2644399 | - | 240 | WP_026821810.1 | hypothetical protein | - |
| QE193_RS13755 (QE193_13760) | 2644727..2645563 | - | 837 | WP_026821809.1 | hypothetical protein | - |
| QE193_RS13760 (QE193_13765) | 2645655..2646512 | - | 858 | WP_026821808.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.82 Da Isoelectric Point: 10.8101
>T279039 WP_026821813.1 NZ_CP123561:c2641812-2641405 [Arsenophonus nasoniae]
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7L3M1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7KWA0 |