Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 11454..12112 | Replicon | plasmid paNv_CH13 |
| Accession | NZ_CP123557 | ||
| Organism | Arsenophonus nasoniae strain aNv_CH | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QE197_RS25850 | Protein ID | WP_135679093.1 |
| Coordinates | 11936..12112 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QE197_RS25845 | Protein ID | WP_135679091.1 |
| Coordinates | 11454..11870 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE197_RS25825 (QE197_25800) | 6929..7756 | + | 828 | WP_135679086.1 | hypothetical protein | - |
| QE197_RS25830 (QE197_25805) | 8043..9035 | + | 993 | WP_135679088.1 | site-specific integrase | - |
| QE197_RS25835 (QE197_25810) | 9297..9890 | + | 594 | WP_135679090.1 | hypothetical protein | - |
| QE197_RS25840 (QE197_25815) | 9890..11323 | + | 1434 | WP_246067639.1 | phage terminase large subunit | - |
| QE197_RS25845 (QE197_25820) | 11454..11870 | - | 417 | WP_135679091.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QE197_RS25850 (QE197_25825) | 11936..12112 | - | 177 | WP_135679093.1 | mRNA interferase | Toxin |
| QE197_RS25855 (QE197_25830) | 12434..12763 | - | 330 | WP_280622557.1 | transposase | - |
| QE197_RS25860 (QE197_25835) | 13024..13242 | - | 219 | WP_280631995.1 | transposase | - |
| QE197_RS25865 (QE197_25840) | 13377..13631 | - | 255 | Protein_19 | transposase zinc-binding domain-containing protein | - |
| QE197_RS25870 (QE197_25845) | 13641..14066 | - | 426 | WP_280622688.1 | hypothetical protein | - |
| QE197_RS25875 (QE197_25850) | 14129..14635 | - | 507 | Protein_21 | IS21-like element helper ATPase IstB | - |
| QE197_RS25880 (QE197_25855) | 14763..15167 | - | 405 | WP_280631970.1 | transposase | - |
| QE197_RS25885 (QE197_25860) | 15074..15286 | - | 213 | WP_280631910.1 | hypothetical protein | - |
| QE197_RS25890 (QE197_25865) | 15283..15561 | - | 279 | WP_280631934.1 | transposase | - |
| QE197_RS25895 (QE197_25870) | 15620..15958 | - | 339 | WP_280631895.1 | transposase zinc-binding domain-containing protein | - |
| QE197_RS25900 (QE197_25875) | 15968..16426 | - | 459 | WP_135678353.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..28012 | 28012 | |
| - | flank | IS/Tn | - | - | 14129..14638 | 509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6630.79 Da Isoelectric Point: 10.9137
>T279038 WP_135679093.1 NZ_CP123557:c12112-11936 [Arsenophonus nasoniae]
VKQSEFLKWLKSQGVKTENGKKHLRLYYKGKISHLPRHGSQELTTGLVEGVKKQLGLK
VKQSEFLKWLKSQGVKTENGKKHLRLYYKGKISHLPRHGSQELTTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15774.23 Da Isoelectric Point: 6.0867
>AT279038 WP_135679091.1 NZ_CP123557:c11870-11454 [Arsenophonus nasoniae]
MFYPAKFTQEDNGYTVSFRDIKDAITCGSSFDEAMSMAEDIILCWIDVYFEKNEFVPMPSDSLYDYEHWVFLPDSIFAKV
LLHNEMLKAKISKAELARLMGTNSPEIQRILSARHKTKIDTISKALSKLGKHLTLSLA
MFYPAKFTQEDNGYTVSFRDIKDAITCGSSFDEAMSMAEDIILCWIDVYFEKNEFVPMPSDSLYDYEHWVFLPDSIFAKV
LLHNEMLKAKISKAELARLMGTNSPEIQRILSARHKTKIDTISKALSKLGKHLTLSLA
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|