Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 20348..20870 Replicon plasmid paNv_CH5
Accession NZ_CP123549
Organism Arsenophonus nasoniae strain aNv_CH

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QE197_RS23405 Protein ID WP_135678791.1
Coordinates 20589..20870 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QE197_RS23400 Protein ID WP_135678793.1
Coordinates 20348..20599 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE197_RS23365 (QE197_23350) 15418..15876 - 459 WP_135678317.1 hypothetical protein -
QE197_RS23370 (QE197_23355) 15989..16189 - 201 WP_135678801.1 hypothetical protein -
QE197_RS23375 (QE197_23360) 16283..17128 - 846 Protein_23 DUF3383 family protein -
QE197_RS23380 (QE197_23365) 17260..17718 + 459 WP_135678771.1 hypothetical protein -
QE197_RS23385 (QE197_23370) 17728..18930 + 1203 WP_135678014.1 IS91 family transposase -
QE197_RS23390 (QE197_23375) 19067..19759 - 693 WP_135678797.1 DUF3383 family protein -
QE197_RS23395 (QE197_23380) 19749..20282 - 534 WP_135678795.1 hypothetical protein -
QE197_RS23400 (QE197_23385) 20348..20599 + 252 WP_135678793.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QE197_RS23405 (QE197_23390) 20589..20870 + 282 WP_135678791.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE197_RS23410 (QE197_23395) 20867..21232 - 366 WP_135678789.1 hypothetical protein -
QE197_RS23415 (QE197_23400) 21229..21699 - 471 WP_280622624.1 hypothetical protein -
QE197_RS23420 (QE197_23405) 21699..22085 - 387 WP_135678445.1 DUF4054 domain-containing protein -
QE197_RS23425 (QE197_23410) 22121..22420 - 300 WP_135678443.1 hypothetical protein -
QE197_RS23430 (QE197_23415) 22522..23490 - 969 WP_135678441.1 DUF2184 domain-containing protein -
QE197_RS23435 (QE197_23420) 23494..23835 - 342 WP_280631973.1 hypothetical protein -
QE197_RS23440 (QE197_23425) 23973..25160 - 1188 WP_135678437.1 DUF2213 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..63188 63188


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11085.10 Da        Isoelectric Point: 10.6178

>T279036 WP_135678791.1 NZ_CP123549:20589-20870 [Arsenophonus nasoniae]
MSYSIEFEKRALKEWKKLAHPIREQFKKKLVKVLEYPHIKSAQLHGHQYRYKIKLKSSGYRLVYEVNDNKLLLLVIAVGI
RANNEVYQLASKR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9343.49 Da        Isoelectric Point: 3.8960

>AT279036 WP_135678793.1 NZ_CP123549:20348-20599 [Arsenophonus nasoniae]
MTYEILTSTVASITDLKRNPMGTVAEAEGNAVAILNRNEPAFYCVPPDLYAYFQELAEDTELNRIADERMKNPEFVSVNI
DEL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References