Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 203356..203891 Replicon plasmid paNv_CH1
Accession NZ_CP123545
Organism Arsenophonus nasoniae strain aNv_CH

Toxin (Protein)


Gene name relE Uniprot ID A0A4P7L9F7
Locus tag QE197_RS20785 Protein ID WP_026824095.1
Coordinates 203604..203891 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4V1BXI0
Locus tag QE197_RS20780 Protein ID WP_026824096.1
Coordinates 203356..203607 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE197_RS20750 (QE197_20750) 199256..200500 + 1245 WP_026823913.1 oligosaccharide flippase family protein -
QE197_RS20755 (QE197_20755) 200656..200985 - 330 WP_280631997.1 transposase -
QE197_RS20760 (QE197_20760) 201017..201328 - 312 WP_280631980.1 hypothetical protein -
QE197_RS20765 (QE197_20765) 201341..201853 - 513 WP_280631961.1 transposase zinc-binding domain-containing protein -
QE197_RS20770 (QE197_20770) 201863..202321 - 459 WP_210409124.1 hypothetical protein -
QE197_RS20775 (QE197_20775) 202381..203274 - 894 WP_081700726.1 type II secretion system F family protein -
QE197_RS20780 (QE197_20780) 203356..203607 + 252 WP_026824096.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QE197_RS20785 (QE197_20785) 203604..203891 + 288 WP_026824095.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE197_RS20795 (QE197_20795) 205829..206082 + 254 Protein_283 transposase zinc-binding domain-containing protein -
QE197_RS20800 (QE197_20800) 206217..206296 + 80 Protein_284 hypothetical protein -
QE197_RS20805 (QE197_20805) 206353..206505 + 153 WP_280632001.1 hypothetical protein -
QE197_RS20810 (QE197_20810) 206621..207024 + 404 Protein_286 transposase -
QE197_RS20815 (QE197_20815) 207149..207424 + 276 WP_026824203.1 hypothetical protein -
QE197_RS20820 (QE197_20820) 207495..207710 - 216 WP_026824204.1 cold-shock protein -
QE197_RS20825 (QE197_20825) 207925..208161 - 237 Protein_289 phosphate-starvation-inducible PsiE family protein -
QE197_RS20830 (QE197_20830) 208271..208396 + 126 WP_276489426.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..222764 222764
- flank IS/Tn - - 205203..205517 314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11252.32 Da        Isoelectric Point: 10.9743

>T279033 WP_026824095.1 NZ_CP123545:203604-203891 [Arsenophonus nasoniae]
MIYKVKFRTDALKEWNNLDRSIQQQFARKLKKCAENPHIPAARLRGMQNCYKIKLRSSGFRLVYQIFKDELIIAVVAVGK
REHSEVYKLASKRLR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9362.58 Da        Isoelectric Point: 4.0543

>AT279033 WP_026824096.1 NZ_CP123545:203356-203607 [Arsenophonus nasoniae]
MPTTILSTTTASITELKTNPMATVNSGDGYPVAILNRNQPAFYCIPAELYEQMLEFIDDQELANLVKERAEQTLHDVNLD
RYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L9F7

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1BXI0

References