Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2640431..2641085 | Replicon | chromosome |
| Accession | NZ_CP123544 | ||
| Organism | Arsenophonus nasoniae strain aNv_CH | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A4P7L3M1 |
| Locus tag | QE197_RS13830 | Protein ID | WP_026821813.1 |
| Coordinates | 2640431..2640838 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A4P7KWA0 |
| Locus tag | QE197_RS13835 | Protein ID | WP_026821812.1 |
| Coordinates | 2640819..2641085 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE197_RS13815 (QE197_13815) | 2636114..2637313 | + | 1200 | WP_135677934.1 | IS91 family transposase | - |
| QE197_RS13820 (QE197_13820) | 2638097..2639410 | + | 1314 | WP_051296926.1 | S8 family serine peptidase | - |
| QE197_RS13825 (QE197_13825) | 2639897..2640415 | + | 519 | WP_026821814.1 | flavodoxin FldB | - |
| QE197_RS13830 (QE197_13830) | 2640431..2640838 | - | 408 | WP_026821813.1 | protein YgfX | Toxin |
| QE197_RS13835 (QE197_13835) | 2640819..2641085 | - | 267 | WP_026821812.1 | FAD assembly factor SdhE | Antitoxin |
| QE197_RS13840 (QE197_13840) | 2641345..2642331 | + | 987 | WP_051296925.1 | tRNA-modifying protein YgfZ | - |
| QE197_RS13845 (QE197_13845) | 2643186..2643425 | - | 240 | WP_026821810.1 | hypothetical protein | - |
| QE197_RS13850 (QE197_13850) | 2643753..2644589 | - | 837 | WP_026821809.1 | hypothetical protein | - |
| QE197_RS13855 (QE197_13855) | 2644681..2645538 | - | 858 | WP_026821808.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.82 Da Isoelectric Point: 10.8101
>T279031 WP_026821813.1 NZ_CP123544:c2640838-2640431 [Arsenophonus nasoniae]
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7L3M1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7KWA0 |