Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 24138..24796 | Replicon | plasmid paNv_CAN4 |
| Accession | NZ_CP123527 | ||
| Organism | Arsenophonus nasoniae strain aNv_CAN | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QE258_RS24320 | Protein ID | WP_135679093.1 |
| Coordinates | 24620..24796 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QE258_RS24315 | Protein ID | WP_135679091.1 |
| Coordinates | 24138..24554 (-) | Length | 139 a.a. |
Genomic Context
Location: 19228..19725 (498 bp)
Type: Others
Protein ID: WP_135678501.1
Type: Others
Protein ID: WP_135678501.1
Location: 19760..20173 (414 bp)
Type: Others
Protein ID: WP_135678499.1
Type: Others
Protein ID: WP_135678499.1
Location: 20214..21242 (1029 bp)
Type: Others
Protein ID: WP_135678497.1
Type: Others
Protein ID: WP_135678497.1
Location: 21505..21978 (474 bp)
Type: Others
Protein ID: WP_280632527.1
Type: Others
Protein ID: WP_280632527.1
Location: 22134..22550 (417 bp)
Type: Others
Protein ID: WP_280632530.1
Type: Others
Protein ID: WP_280632530.1
Location: 22445..22822 (378 bp)
Type: Others
Protein ID: WP_280632528.1
Type: Others
Protein ID: WP_280632528.1
Location: 22717..22938 (222 bp)
Type: Others
Protein ID: WP_280632011.1
Type: Others
Protein ID: WP_280632011.1
Location: 22988..23152 (165 bp)
Type: Others
Protein ID: WP_280631913.1
Type: Others
Protein ID: WP_280631913.1
Location: 23188..23325 (138 bp)
Type: Others
Protein ID: Protein_38
Type: Others
Protein ID: Protein_38
Location: 23335..23793 (459 bp)
Type: Others
Protein ID: WP_135678353.1
Type: Others
Protein ID: WP_135678353.1
Location: 24138..24554 (417 bp)
Type: Antitoxin
Protein ID: WP_135679091.1
Type: Antitoxin
Protein ID: WP_135679091.1
Location: 24620..24796 (177 bp)
Type: Toxin
Protein ID: WP_135679093.1
Type: Toxin
Protein ID: WP_135679093.1
Location: 25118..25915 (798 bp)
Type: Others
Protein ID: WP_280632529.1
Type: Others
Protein ID: WP_280632529.1
Location: 25801..26313 (513 bp)
Type: Others
Protein ID: WP_280631961.1
Type: Others
Protein ID: WP_280631961.1
Location: 26323..26748 (426 bp)
Type: Others
Protein ID: WP_280622688.1
Type: Others
Protein ID: WP_280622688.1
Location: 26811..27572 (762 bp)
Type: Others
Protein ID: WP_135677409.1
Type: Others
Protein ID: WP_135677409.1
Location: 27559..28599 (1041 bp)
Type: Others
Protein ID: WP_135677398.1
Type: Others
Protein ID: WP_135677398.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE258_RS24265 (QE258_24275) | 19228..19725 | + | 498 | WP_135678501.1 | lysis protein | - |
| QE258_RS24270 (QE258_24280) | 19760..20173 | + | 414 | WP_135678499.1 | hypothetical protein | - |
| QE258_RS24275 (QE258_24285) | 20214..21242 | + | 1029 | WP_135678497.1 | tyrosine-type recombinase/integrase | - |
| QE258_RS24280 (QE258_24290) | 21505..21978 | + | 474 | WP_280632527.1 | hypothetical protein | - |
| QE258_RS24285 (QE258_24295) | 22134..22550 | - | 417 | WP_280632530.1 | transposase | - |
| QE258_RS24290 (QE258_24300) | 22445..22822 | - | 378 | WP_280632528.1 | hypothetical protein | - |
| QE258_RS24295 (QE258_24305) | 22717..22938 | - | 222 | WP_280632011.1 | transposase | - |
| QE258_RS24300 (QE258_24310) | 22988..23152 | - | 165 | WP_280631913.1 | transposase zinc-binding domain-containing protein | - |
| QE258_RS24305 (QE258_24315) | 23188..23325 | - | 138 | Protein_38 | IS91 family transposase | - |
| QE258_RS24310 (QE258_24320) | 23335..23793 | - | 459 | WP_135678353.1 | hypothetical protein | - |
| QE258_RS24315 (QE258_24325) | 24138..24554 | - | 417 | WP_135679091.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QE258_RS24320 (QE258_24330) | 24620..24796 | - | 177 | WP_135679093.1 | mRNA interferase | Toxin |
| QE258_RS24325 (QE258_24335) | 25118..25915 | - | 798 | WP_280632529.1 | transposase | - |
| QE258_RS24330 (QE258_24340) | 25801..26313 | - | 513 | WP_280631961.1 | transposase zinc-binding domain-containing protein | - |
| QE258_RS24335 (QE258_24345) | 26323..26748 | - | 426 | WP_280622688.1 | hypothetical protein | - |
| QE258_RS24340 (QE258_24350) | 26811..27572 | - | 762 | WP_135677409.1 | IS21-like element helper ATPase IstB | - |
| QE258_RS24345 (QE258_24355) | 27559..28599 | - | 1041 | WP_135677398.1 | IS21 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..76652 | 76652 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6630.79 Da Isoelectric Point: 10.9137
>T279029 WP_135679093.1 NZ_CP123527:c24796-24620 [Arsenophonus nasoniae]
VKQSEFLKWLKSQGVKTENGKKHLRLYYKGKISHLPRHGSQELTTGLVEGVKKQLGLK
VKQSEFLKWLKSQGVKTENGKKHLRLYYKGKISHLPRHGSQELTTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15774.23 Da Isoelectric Point: 6.0867
>AT279029 WP_135679091.1 NZ_CP123527:c24554-24138 [Arsenophonus nasoniae]
MFYPAKFTQEDNGYTVSFRDIKDAITCGSSFDEAMSMAEDIILCWIDVYFEKNEFVPMPSDSLYDYEHWVFLPDSIFAKV
LLHNEMLKAKISKAELARLMGTNSPEIQRILSARHKTKIDTISKALSKLGKHLTLSLA
MFYPAKFTQEDNGYTVSFRDIKDAITCGSSFDEAMSMAEDIILCWIDVYFEKNEFVPMPSDSLYDYEHWVFLPDSIFAKV
LLHNEMLKAKISKAELARLMGTNSPEIQRILSARHKTKIDTISKALSKLGKHLTLSLA
Download Length: 417 bp