Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 53192..53828 Replicon plasmid paNv_CAN3
Accession NZ_CP123526
Organism Arsenophonus nasoniae strain aNv_CAN

Toxin (Protein)


Gene name vapC Uniprot ID A0A4P7L2E3
Locus tag QE258_RS23605 Protein ID WP_026823396.1
Coordinates 53192..53596 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A4P7L1M6
Locus tag QE258_RS23610 Protein ID WP_026823397.1
Coordinates 53589..53828 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE258_RS23570 (QE258_23580) 49219..49587 - 369 WP_026823391.1 hypothetical protein -
QE258_RS23575 (QE258_23585) 49565..50158 - 594 WP_026823392.1 hypothetical protein -
QE258_RS23580 (QE258_23590) 50161..50916 - 756 WP_135678964.1 signal peptidase I -
QE258_RS23585 (QE258_23595) 50965..51399 - 435 WP_026823394.1 hypothetical protein -
QE258_RS23590 (QE258_23600) 51401..51577 - 177 WP_167876777.1 hypothetical protein -
QE258_RS23595 (QE258_23605) 51627..51785 - 159 WP_155846998.1 hypothetical protein -
QE258_RS23600 (QE258_23610) 51782..52747 - 966 WP_051297076.1 tyrosine-type recombinase/integrase -
QE258_RS23605 (QE258_23615) 53192..53596 - 405 WP_026823396.1 type II toxin-antitoxin system VapC family toxin Toxin
QE258_RS23610 (QE258_23620) 53589..53828 - 240 WP_026823397.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QE258_RS23615 (QE258_23625) 53935..54318 - 384 WP_026823398.1 hypothetical protein -
QE258_RS23620 (QE258_23630) 54336..55025 - 690 WP_026823399.1 hypothetical protein -
QE258_RS23625 (QE258_23635) 55477..56636 + 1160 WP_135677411.1 IS3 family transposase -
QE258_RS23630 (QE258_23640) 56626..57681 + 1056 WP_135678962.1 IS21 family transposase -
QE258_RS23635 (QE258_23645) 57668..58429 + 762 WP_135677409.1 IS21-like element helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..140345 140345
- flank IS/Tn - - 55477..55791 314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15217.49 Da        Isoelectric Point: 8.5036

>T279027 WP_026823396.1 NZ_CP123526:c53596-53192 [Arsenophonus nasoniae]
MIKYLLDTNIVIFTIKRKPVSLLPKFNQHTNQLAISAITFAELIFGAEKSMNSAKNLATVNDFVSRLTVLPYDEQAAFHY
GDIKANFEKKEKPIGDNDLHIAAHARSKGLVVVTNNTREFERVEGLRIEDWTQL

Download         Length: 405 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9195.27 Da        Isoelectric Point: 4.7420

>AT279027 WP_026823397.1 NZ_CP123526:c53828-53589 [Arsenophonus nasoniae]
MIQQGKVFMSNRTQNVRLPADTRFPDDVKDVIVRVKGKERIISPVQNAWDSFFLSEQSVTDDFLSNRTEQITSERESFD

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L2E3

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7L1M6

References