Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 17543..18078 Replicon plasmid paNv_CAN1
Accession NZ_CP123524
Organism Arsenophonus nasoniae strain aNv_CAN

Toxin (Protein)


Gene name relE Uniprot ID A0A4P7L9F7
Locus tag QE258_RS20910 Protein ID WP_026824095.1
Coordinates 17543..17830 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4V1BXI0
Locus tag QE258_RS20915 Protein ID WP_026824096.1
Coordinates 17827..18078 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE258_RS20870 (QE258_20875) 13035..13160 - 126 WP_276489426.1 hypothetical protein -
QE258_RS20875 (QE258_20880) 13270..13506 + 237 Protein_26 phosphate-starvation-inducible PsiE family protein -
QE258_RS20880 (QE258_20885) 13721..13936 + 216 WP_026824204.1 cold-shock protein -
QE258_RS20885 (QE258_20890) 14007..14282 - 276 WP_026824203.1 hypothetical protein -
QE258_RS20890 (QE258_20895) 14407..14736 - 330 WP_280622557.1 transposase -
QE258_RS20895 (QE258_20900) 14768..14929 - 162 WP_280631944.1 hypothetical protein -
QE258_RS20900 (QE258_20905) 14991..15605 - 615 WP_280632490.1 transposase zinc-binding domain-containing protein -
QE258_RS20905 (QE258_20910) 15917..17076 + 1160 WP_135678367.1 IS3 family transposase -
QE258_RS20910 (QE258_20915) 17543..17830 - 288 WP_026824095.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE258_RS20915 (QE258_20920) 17827..18078 - 252 WP_026824096.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QE258_RS20920 (QE258_20925) 18160..19053 + 894 WP_081700726.1 type II secretion system F family protein -
QE258_RS20925 (QE258_20930) 19113..19235 + 123 WP_276489417.1 hypothetical protein -
QE258_RS20930 (QE258_20935) 19578..19916 + 339 WP_280631895.1 transposase zinc-binding domain-containing protein -
QE258_RS20935 (QE258_20940) 19975..20190 + 216 WP_280631986.1 transposase -
QE258_RS20940 (QE258_20945) 20371..20774 + 404 Protein_39 transposase -
QE258_RS20945 (QE258_20950) 20930..22174 - 1245 WP_026823913.1 oligosaccharide flippase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..226576 226576
- flank IS/Tn - - 15917..16231 314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11252.32 Da        Isoelectric Point: 10.9743

>T279025 WP_026824095.1 NZ_CP123524:c17830-17543 [Arsenophonus nasoniae]
MIYKVKFRTDALKEWNNLDRSIQQQFARKLKKCAENPHIPAARLRGMQNCYKIKLRSSGFRLVYQIFKDELIIAVVAVGK
REHSEVYKLASKRLR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9362.58 Da        Isoelectric Point: 4.0543

>AT279025 WP_026824096.1 NZ_CP123524:c18078-17827 [Arsenophonus nasoniae]
MPTTILSTTTASITELKTNPMATVNSGDGYPVAILNRNQPAFYCIPAELYEQMLEFIDDQELANLVKERAEQTLHDVNLD
RYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L9F7

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1BXI0

References