Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3068558..3069186 | Replicon | chromosome |
Accession | NZ_CP123523 | ||
Organism | Arsenophonus nasoniae strain aNv_CAN |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D2TWD5 |
Locus tag | QE258_RS16425 | Protein ID | WP_026821483.1 |
Coordinates | 3068983..3069186 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A4P7KX12 |
Locus tag | QE258_RS16420 | Protein ID | WP_026821484.1 |
Coordinates | 3068558..3068926 (+) | Length | 123 a.a. |
Genomic Context
Location: 3063713..3064876 (1164 bp)
Type: Others
Protein ID: WP_026821486.1
Type: Others
Protein ID: WP_026821486.1
Location: 3064919..3068038 (3120 bp)
Type: Others
Protein ID: WP_026821485.1
Type: Others
Protein ID: WP_026821485.1
Location: 3068558..3068926 (369 bp)
Type: Antitoxin
Protein ID: WP_026821484.1
Type: Antitoxin
Protein ID: WP_026821484.1
Location: 3068983..3069186 (204 bp)
Type: Toxin
Protein ID: WP_026821483.1
Type: Toxin
Protein ID: WP_026821483.1
Location: 3069984..3071764 (1781 bp)
Type: Others
Protein ID: Protein_3207
Type: Others
Protein ID: Protein_3207
Location: 3071757..3073503 (1747 bp)
Type: Others
Protein ID: Protein_3208
Type: Others
Protein ID: Protein_3208
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE258_RS16410 (QE258_16415) | 3063713..3064876 | + | 1164 | WP_026821486.1 | efflux RND transporter periplasmic adaptor subunit | - |
QE258_RS16415 (QE258_16420) | 3064919..3068038 | + | 3120 | WP_026821485.1 | efflux RND transporter permease subunit | - |
QE258_RS16420 (QE258_16425) | 3068558..3068926 | + | 369 | WP_026821484.1 | Hha toxicity modulator TomB | Antitoxin |
QE258_RS16425 (QE258_16430) | 3068983..3069186 | + | 204 | WP_026821483.1 | HHA domain-containing protein | Toxin |
QE258_RS16435 (QE258_16440) | 3069984..3071764 | - | 1781 | Protein_3207 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
QE258_RS16440 (QE258_16445) | 3071757..3073503 | - | 1747 | Protein_3208 | SmdA family multidrug ABC transporter permease/ATP-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8133.45 Da Isoelectric Point: 6.9767
>T279024 WP_026821483.1 NZ_CP123523:3068983-3069186 [Arsenophonus nasoniae]
MTKIDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
MTKIDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14453.41 Da Isoelectric Point: 5.1197
>AT279024 WP_026821484.1 NZ_CP123523:3068558-3068926 [Arsenophonus nasoniae]
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLSEILTNDIKYSLSNT
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLSEILTNDIKYSLSNT
Download Length: 369 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | D2TWD5 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7KX12 |