Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2753720..2754374 | Replicon | chromosome |
| Accession | NZ_CP123523 | ||
| Organism | Arsenophonus nasoniae strain aNv_CAN | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A4P7L3M1 |
| Locus tag | QE258_RS14655 | Protein ID | WP_026821813.1 |
| Coordinates | 2753720..2754127 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A4P7KWA0 |
| Locus tag | QE258_RS14660 | Protein ID | WP_026821812.1 |
| Coordinates | 2754108..2754374 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE258_RS14640 (QE258_14645) | 2749406..2750353 | + | 948 | WP_280632308.1 | IS91 family transposase | - |
| QE258_RS14645 (QE258_14650) | 2751386..2752699 | + | 1314 | WP_051296926.1 | S8 family serine peptidase | - |
| QE258_RS14650 (QE258_14655) | 2753186..2753704 | + | 519 | WP_026821814.1 | flavodoxin FldB | - |
| QE258_RS14655 (QE258_14660) | 2753720..2754127 | - | 408 | WP_026821813.1 | protein YgfX | Toxin |
| QE258_RS14660 (QE258_14665) | 2754108..2754374 | - | 267 | WP_026821812.1 | FAD assembly factor SdhE | Antitoxin |
| QE258_RS14665 (QE258_14670) | 2754634..2755620 | + | 987 | WP_051296925.1 | tRNA-modifying protein YgfZ | - |
| QE258_RS14670 (QE258_14675) | 2756475..2756714 | - | 240 | WP_026821810.1 | hypothetical protein | - |
| QE258_RS14675 (QE258_14680) | 2757042..2757878 | - | 837 | WP_026821809.1 | hypothetical protein | - |
| QE258_RS14680 (QE258_14685) | 2757970..2758827 | - | 858 | WP_026821808.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.82 Da Isoelectric Point: 10.8101
>T279023 WP_026821813.1 NZ_CP123523:c2754127-2753720 [Arsenophonus nasoniae]
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7L3M1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7KWA0 |