Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 89017..89552 Replicon plasmid paPv3
Accession NZ_CP123507
Organism Arsenophonus nasoniae strain aPv

Toxin (Protein)


Gene name relE Uniprot ID A0A4P7L9F7
Locus tag QE210_RS19460 Protein ID WP_026824095.1
Coordinates 89017..89304 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4V1BXI0
Locus tag QE210_RS19465 Protein ID WP_026824096.1
Coordinates 89301..89552 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE210_RS19440 (QE210_19350) 84086..85126 - 1041 WP_280626854.1 IS481 family transposase -
QE210_RS19445 (QE210_19355) 85754..86656 + 903 Protein_104 conjugative transfer relaxase/helicase TraI -
QE210_RS19450 (QE210_19360) 86805..88469 + 1665 WP_280626390.1 type III secretion system effector inositol phosphate phosphatase -
QE210_RS19455 (QE210_19365) 88477..88884 + 408 WP_280626391.1 hypothetical protein -
QE210_RS19460 (QE210_19370) 89017..89304 - 288 WP_026824095.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE210_RS19465 (QE210_19375) 89301..89552 - 252 WP_026824096.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QE210_RS19470 (QE210_19380) 89634..90713 + 1080 WP_280626792.1 type II secretion system F family protein -
QE210_RS19475 (QE210_19385) 90717..91343 + 627 WP_280626793.1 type 4 pilus major pilin -
QE210_RS19480 (QE210_19390) 91437..91901 + 465 WP_280626855.1 lytic transglycosylase domain-containing protein -
QE210_RS19485 (QE210_19395) 92060..92644 + 585 Protein_112 helix-turn-helix domain-containing protein -
QE210_RS19490 (QE210_19400) 92805..94004 - 1200 WP_280624651.1 IS91 family transposase -
QE210_RS19495 (QE210_19405) 94090..94248 + 159 Protein_114 phospholipase D-like domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..94250 94250
- flank IS/Tn - - 84086..85033 947
- flank IS/Tn - - 92060..92656 596


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11252.32 Da        Isoelectric Point: 10.9743

>T279018 WP_026824095.1 NZ_CP123507:c89304-89017 [Arsenophonus nasoniae]
MIYKVKFRTDALKEWNNLDRSIQQQFARKLKKCAENPHIPAARLRGMQNCYKIKLRSSGFRLVYQIFKDELIIAVVAVGK
REHSEVYKLASKRLR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9362.58 Da        Isoelectric Point: 4.0543

>AT279018 WP_026824096.1 NZ_CP123507:c89552-89301 [Arsenophonus nasoniae]
MPTTILSTTTASITELKTNPMATVNSGDGYPVAILNRNQPAFYCIPAELYEQMLEFIDDQELANLVKERAEQTLHDVNLD
RYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L9F7

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1BXI0

References