Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2891773..2892401 | Replicon | chromosome |
Accession | NZ_CP123504 | ||
Organism | Arsenophonus nasoniae strain aPv |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D2TWD5 |
Locus tag | QE210_RS14550 | Protein ID | WP_026821483.1 |
Coordinates | 2892198..2892401 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | QE210_RS14545 | Protein ID | WP_280624621.1 |
Coordinates | 2891773..2892141 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE210_RS14535 (QE210_14465) | 2886927..2888090 | + | 1164 | WP_026821486.1 | efflux RND transporter periplasmic adaptor subunit | - |
QE210_RS14540 (QE210_14470) | 2888133..2891252 | + | 3120 | WP_280624620.1 | efflux RND transporter permease subunit | - |
QE210_RS14545 (QE210_14475) | 2891773..2892141 | + | 369 | WP_280624621.1 | Hha toxicity modulator TomB | Antitoxin |
QE210_RS14550 (QE210_14480) | 2892198..2892401 | + | 204 | WP_026821483.1 | HHA domain-containing protein | Toxin |
QE210_RS14560 (QE210_14490) | 2893199..2894986 | - | 1788 | WP_280624623.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
QE210_RS14565 (QE210_14495) | 2894973..2896721 | - | 1749 | WP_280624625.1 | SmdA family multidrug ABC transporter permease/ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8133.45 Da Isoelectric Point: 6.9767
>T279015 WP_026821483.1 NZ_CP123504:2892198-2892401 [Arsenophonus nasoniae]
MTKIDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
MTKIDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14426.39 Da Isoelectric Point: 5.1197
>AT279015 WP_280624621.1 NZ_CP123504:2891773-2892141 [Arsenophonus nasoniae]
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYSLFGKPVMSLTDISDWQKMNEHLSEILTNDIKYSLSNT
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYSLFGKPVMSLTDISDWQKMNEHLSEILTNDIKYSLSNT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|