Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2639046..2639700 | Replicon | chromosome |
| Accession | NZ_CP123504 | ||
| Organism | Arsenophonus nasoniae strain aPv | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A4P7L3M1 |
| Locus tag | QE210_RS13195 | Protein ID | WP_026821813.1 |
| Coordinates | 2639046..2639453 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A4P7KWA0 |
| Locus tag | QE210_RS13200 | Protein ID | WP_026821812.1 |
| Coordinates | 2639434..2639700 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE210_RS13175 (QE210_13110) | 2634430..2634621 | + | 192 | WP_280624333.1 | hypothetical protein | - |
| QE210_RS13180 (QE210_13115) | 2634904..2636193 | + | 1290 | WP_280624334.1 | hypothetical protein | - |
| QE210_RS13185 (QE210_13120) | 2636714..2638027 | + | 1314 | WP_280624335.1 | S8 family serine peptidase | - |
| QE210_RS13190 (QE210_13125) | 2638512..2639030 | + | 519 | WP_026821814.1 | flavodoxin FldB | - |
| QE210_RS13195 (QE210_13130) | 2639046..2639453 | - | 408 | WP_026821813.1 | protein YgfX | Toxin |
| QE210_RS13200 (QE210_13135) | 2639434..2639700 | - | 267 | WP_026821812.1 | FAD assembly factor SdhE | Antitoxin |
| QE210_RS13205 (QE210_13140) | 2639960..2640946 | + | 987 | WP_280624336.1 | tRNA-modifying protein YgfZ | - |
| QE210_RS13210 (QE210_13145) | 2641801..2642139 | - | 339 | WP_280624338.1 | hypothetical protein | - |
| QE210_RS13215 (QE210_13150) | 2642384..2643220 | - | 837 | WP_280624340.1 | hypothetical protein | - |
| QE210_RS13220 (QE210_13155) | 2643312..2644169 | - | 858 | WP_280624342.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.82 Da Isoelectric Point: 10.8101
>T279014 WP_026821813.1 NZ_CP123504:c2639453-2639046 [Arsenophonus nasoniae]
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7L3M1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7KWA0 |