Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-MazE |
| Location | 4967..5625 | Replicon | plasmid paPb4 |
| Accession | NZ_CP123503 | ||
| Organism | Arsenophonus sp. aPb | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QE177_RS15570 | Protein ID | WP_280552705.1 |
| Coordinates | 5233..5625 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QE177_RS15565 | Protein ID | WP_280552703.1 |
| Coordinates | 4967..5230 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE177_RS15545 (QE177_15545) | 828..2423 | - | 1596 | WP_280552697.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| QE177_RS15550 (QE177_15550) | 2420..2731 | - | 312 | WP_280552699.1 | hypothetical protein | - |
| QE177_RS15555 (QE177_15555) | 2728..3351 | - | 624 | WP_280552701.1 | helix-turn-helix domain-containing protein | - |
| QE177_RS15560 (QE177_15560) | 3566..4264 | - | 699 | WP_280552719.1 | replication initiation protein | - |
| QE177_RS15565 (QE177_15565) | 4967..5230 | + | 264 | WP_280552703.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QE177_RS15570 (QE177_15570) | 5233..5625 | + | 393 | WP_280552705.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QE177_RS15575 (QE177_15575) | 5733..6095 | - | 363 | WP_280552707.1 | plasmid partitioning/stability family protein | - |
| QE177_RS15580 (QE177_15580) | 6098..7060 | - | 963 | WP_280552709.1 | plasmid segregation protein ParM | - |
| QE177_RS15585 (QE177_15585) | 7315..8457 | - | 1143 | WP_280552712.1 | cytosine permease | - |
| QE177_RS15590 (QE177_15590) | 8540..9223 | - | 684 | WP_280548476.1 | IS6 family transposase | - |
| QE177_RS15595 (QE177_15595) | 9354..9479 | + | 126 | WP_280552714.1 | hypothetical protein | - |
| QE177_RS15600 (QE177_15600) | 9543..10226 | + | 684 | WP_280548476.1 | IS6 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..27155 | 27155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14719.29 Da Isoelectric Point: 10.1279
>T279012 WP_280552705.1 NZ_CP123503:5233-5625 [Arsenophonus sp. aPb]
MYMLDTNIVSHLFRKNQLVIKKLNNIPPSKVCISSITQAELLYGVAKRNNKALKKLVNIFLNSIEIIDWNEKDARVYGEL
RAKMESKGHVMGSLDMLIAAHALSRKKTIVTNDNAFSMATGLLVEDWTKE
MYMLDTNIVSHLFRKNQLVIKKLNNIPPSKVCISSITQAELLYGVAKRNNKALKKLVNIFLNSIEIIDWNEKDARVYGEL
RAKMESKGHVMGSLDMLIAAHALSRKKTIVTNDNAFSMATGLLVEDWTKE
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|