Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 44474..45008 | Replicon | plasmid paPb1 |
| Accession | NZ_CP123500 | ||
| Organism | Arsenophonus sp. aPb | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QE177_RS14640 | Protein ID | WP_280552407.1 |
| Coordinates | 44474..44767 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QE177_RS14645 | Protein ID | WP_280552409.1 |
| Coordinates | 44757..45008 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE177_RS14610 (QE177_14610) | 40380..41093 | + | 714 | WP_280552395.1 | VUT family protein | - |
| QE177_RS14615 (QE177_14615) | 41071..41799 | + | 729 | WP_280552397.1 | metallophosphoesterase | - |
| QE177_RS14620 (QE177_14620) | 41796..42317 | - | 522 | WP_280552398.1 | hypothetical protein | - |
| QE177_RS14625 (QE177_14625) | 42320..42958 | - | 639 | WP_280552400.1 | helix-turn-helix domain-containing protein | - |
| QE177_RS14630 (QE177_14630) | 43170..43508 | + | 339 | WP_280552403.1 | type IV conjugative transfer system pilin TraA | - |
| QE177_RS14635 (QE177_14635) | 43778..44326 | + | 549 | WP_280552405.1 | hypothetical protein | - |
| QE177_RS14640 (QE177_14640) | 44474..44767 | - | 294 | WP_280552407.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QE177_RS14645 (QE177_14645) | 44757..45008 | - | 252 | WP_280552409.1 | plasmid stabilization protein | Antitoxin |
| QE177_RS14650 (QE177_14650) | 45090..47132 | + | 2043 | WP_280552305.1 | type IV conjugative transfer system coupling protein TraD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..89842 | 89842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11643.60 Da Isoelectric Point: 10.4957
>T279011 WP_280552407.1 NZ_CP123500:c44767-44474 [Arsenophonus sp. aPb]
MNYELQFEKRALKEWKKLPQPIKEQFKKKLNERLQNPHIISAKLSGSINRYKIKLRSSGYRLVYEVDDEKITVYVIAVGK
RERSEVYILAKDRNIFN
MNYELQFEKRALKEWKKLPQPIKEQFKKKLNERLQNPHIISAKLSGSINRYKIKLRSSGYRLVYEVDDEKITVYVIAVGK
RERSEVYILAKDRNIFN
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|