Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2336712..2337366 | Replicon | chromosome |
| Accession | NZ_CP123499 | ||
| Organism | Arsenophonus sp. aPb | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | QE177_RS10460 | Protein ID | WP_180558768.1 |
| Coordinates | 2336712..2337119 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A4P7KWA0 |
| Locus tag | QE177_RS10465 | Protein ID | WP_026821812.1 |
| Coordinates | 2337100..2337366 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE177_RS10445 (QE177_10445) | 2332102..2333889 | + | 1788 | WP_280549402.1 | hypothetical protein | - |
| QE177_RS10450 (QE177_10450) | 2334382..2335695 | + | 1314 | WP_280549404.1 | S8 family serine peptidase | - |
| QE177_RS10455 (QE177_10455) | 2336178..2336696 | + | 519 | WP_280549407.1 | flavodoxin FldB | - |
| QE177_RS10460 (QE177_10460) | 2336712..2337119 | - | 408 | WP_180558768.1 | protein YgfX | Toxin |
| QE177_RS10465 (QE177_10465) | 2337100..2337366 | - | 267 | WP_026821812.1 | FAD assembly factor SdhE | Antitoxin |
| QE177_RS10470 (QE177_10470) | 2337626..2338612 | + | 987 | WP_280549415.1 | tRNA-modifying protein YgfZ | - |
| QE177_RS10475 (QE177_10475) | 2339483..2339815 | - | 333 | WP_280549418.1 | hypothetical protein | - |
| QE177_RS10480 (QE177_10480) | 2340066..2340902 | - | 837 | WP_280549420.1 | hypothetical protein | - |
| QE177_RS10485 (QE177_10485) | 2340995..2341852 | - | 858 | WP_280549422.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.82 Da Isoelectric Point: 10.8101
>T279010 WP_180558768.1 NZ_CP123499:c2337119-2336712 [Arsenophonus sp. aPb]
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSLVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSLVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|