Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2250792..2251420 | Replicon | chromosome |
Accession | NZ_CP123498 | ||
Organism | Arsenophonus nasoniae strain aIh |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | QE207_RS12780 | Protein ID | WP_280628822.1 |
Coordinates | 2251217..2251420 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | QE207_RS12775 | Protein ID | WP_280628821.1 |
Coordinates | 2250792..2251160 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE207_RS12765 (QE207_12755) | 2245945..2247108 | + | 1164 | WP_280628819.1 | efflux RND transporter periplasmic adaptor subunit | - |
QE207_RS12770 (QE207_12760) | 2247151..2250270 | + | 3120 | WP_280628820.1 | efflux RND transporter permease subunit | - |
QE207_RS12775 (QE207_12765) | 2250792..2251160 | + | 369 | WP_280628821.1 | Hha toxicity modulator TomB | Antitoxin |
QE207_RS12780 (QE207_12770) | 2251217..2251420 | + | 204 | WP_280628822.1 | HHA domain-containing protein | Toxin |
QE207_RS12790 (QE207_12780) | 2252217..2254004 | - | 1788 | WP_280628823.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
QE207_RS12795 (QE207_12785) | 2253991..2255739 | - | 1749 | WP_280628824.1 | SmdA family multidrug ABC transporter permease/ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8193.54 Da Isoelectric Point: 6.9767
>T279006 WP_280628822.1 NZ_CP123498:2251217-2251420 [Arsenophonus nasoniae]
MTKIDYLMRLRKCTTIETLERVIEKNKYELFEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
MTKIDYLMRLRKCTTIETLERVIEKNKYELFEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14437.42 Da Isoelectric Point: 5.1197
>AT279006 WP_280628821.1 NZ_CP123498:2250792-2251160 [Arsenophonus nasoniae]
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLAEILTNDIKYSLSNT
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLAEILTNDIKYSLSNT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|