Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2250792..2251420 | Replicon | chromosome |
Accession | NZ_CP123498 | ||
Organism | Arsenophonus nasoniae strain aIh |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | QE207_RS12780 | Protein ID | WP_280628822.1 |
Coordinates | 2251217..2251420 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | QE207_RS12775 | Protein ID | WP_280628821.1 |
Coordinates | 2250792..2251160 (+) | Length | 123 a.a. |
Genomic Context
Location: 2245945..2247108 (1164 bp)
Type: Others
Protein ID: WP_280628819.1
Type: Others
Protein ID: WP_280628819.1
Location: 2247151..2250270 (3120 bp)
Type: Others
Protein ID: WP_280628820.1
Type: Others
Protein ID: WP_280628820.1
Location: 2250792..2251160 (369 bp)
Type: Antitoxin
Protein ID: WP_280628821.1
Type: Antitoxin
Protein ID: WP_280628821.1
Location: 2251217..2251420 (204 bp)
Type: Toxin
Protein ID: WP_280628822.1
Type: Toxin
Protein ID: WP_280628822.1
Location: 2252217..2254004 (1788 bp)
Type: Others
Protein ID: WP_280628823.1
Type: Others
Protein ID: WP_280628823.1
Location: 2253991..2255739 (1749 bp)
Type: Others
Protein ID: WP_280628824.1
Type: Others
Protein ID: WP_280628824.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE207_RS12765 (QE207_12755) | 2245945..2247108 | + | 1164 | WP_280628819.1 | efflux RND transporter periplasmic adaptor subunit | - |
QE207_RS12770 (QE207_12760) | 2247151..2250270 | + | 3120 | WP_280628820.1 | efflux RND transporter permease subunit | - |
QE207_RS12775 (QE207_12765) | 2250792..2251160 | + | 369 | WP_280628821.1 | Hha toxicity modulator TomB | Antitoxin |
QE207_RS12780 (QE207_12770) | 2251217..2251420 | + | 204 | WP_280628822.1 | HHA domain-containing protein | Toxin |
QE207_RS12790 (QE207_12780) | 2252217..2254004 | - | 1788 | WP_280628823.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
QE207_RS12795 (QE207_12785) | 2253991..2255739 | - | 1749 | WP_280628824.1 | SmdA family multidrug ABC transporter permease/ATP-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8193.54 Da Isoelectric Point: 6.9767
>T279006 WP_280628822.1 NZ_CP123498:2251217-2251420 [Arsenophonus nasoniae]
MTKIDYLMRLRKCTTIETLERVIEKNKYELFEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
MTKIDYLMRLRKCTTIETLERVIEKNKYELFEDELELFYSAADHRLAELTMNKLYDKIPSSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14437.42 Da Isoelectric Point: 5.1197
>AT279006 WP_280628821.1 NZ_CP123498:2250792-2251160 [Arsenophonus nasoniae]
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLAEILTNDIKYSLSNT
MDEYSPRSYDILVLKYLCDALHRDAMLTLHRTKTHWKNDLGSDQNVKFNVLIDHITDFIGQFKLKYPNNVNLFIFIDEYL
DETYNLFGKPVMSLTDISDWQKMNEHLAEILTNDIKYSLSNT
Download Length: 369 bp