Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-couple_hipB |
Location | 1800986..1802625 | Replicon | chromosome |
Accession | NZ_CP123498 | ||
Organism | Arsenophonus nasoniae strain aIh |
Toxin (Protein)
Gene name | HipA3 | Uniprot ID | - |
Locus tag | QE207_RS10855 | Protein ID | WP_280628594.1 |
Coordinates | 1800986..1802302 (-) | Length | 439 a.a. |
Antitoxin (Protein)
Gene name | HipB3 | Uniprot ID | - |
Locus tag | QE207_RS10860 | Protein ID | WP_026823614.1 |
Coordinates | 1802296..1802625 (-) | Length | 110 a.a. |
Genomic Context
Location: 1799774..1800451 (678 bp)
Type: Others
Protein ID: WP_280628592.1
Type: Others
Protein ID: WP_280628592.1
Location: 1800448..1800585 (138 bp)
Type: Others
Protein ID: WP_280628593.1
Type: Others
Protein ID: WP_280628593.1
Location: 1800696..1800794 (99 bp)
Type: Others
Protein ID: WP_280626126.1
Type: Others
Protein ID: WP_280626126.1
Location: 1802912..1803718 (807 bp)
Type: Others
Protein ID: WP_280628595.1
Type: Others
Protein ID: WP_280628595.1
Location: 1804870..1805460 (591 bp)
Type: Others
Protein ID: WP_026823615.1
Type: Others
Protein ID: WP_026823615.1
Location: 1797983..1798780 (798 bp)
Type: Others
Protein ID: WP_280628591.1
Type: Others
Protein ID: WP_280628591.1
Location: 1800986..1802302 (1317 bp)
Type: Toxin
Protein ID: WP_280628594.1
Type: Toxin
Protein ID: WP_280628594.1
Location: 1802296..1802625 (330 bp)
Type: Antitoxin
Protein ID: WP_026823614.1
Type: Antitoxin
Protein ID: WP_026823614.1
Location: 1803731..1804642 (912 bp)
Type: Others
Protein ID: WP_280628596.1
Type: Others
Protein ID: WP_280628596.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE207_RS10835 (QE207_10825) | 1797983..1798780 | - | 798 | WP_280628591.1 | hypothetical protein | - |
QE207_RS10840 (QE207_10830) | 1799774..1800451 | + | 678 | WP_280628592.1 | ankyrin repeat domain-containing protein | - |
QE207_RS10845 (QE207_10835) | 1800448..1800585 | + | 138 | WP_280628593.1 | hypothetical protein | - |
QE207_RS10850 (QE207_10840) | 1800696..1800794 | + | 99 | WP_280626126.1 | hypothetical protein | - |
QE207_RS10855 (QE207_10845) | 1800986..1802302 | - | 1317 | WP_280628594.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
QE207_RS10860 (QE207_10850) | 1802296..1802625 | - | 330 | WP_026823614.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QE207_RS10865 (QE207_10855) | 1802912..1803718 | + | 807 | WP_280628595.1 | 2,5-didehydrogluconate reductase DkgB | - |
QE207_RS10870 (QE207_10860) | 1803731..1804642 | - | 912 | WP_280628596.1 | DNA-binding transcriptional regulator YafC | - |
QE207_RS10875 (QE207_10865) | 1804870..1805460 | + | 591 | WP_026823615.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 439 a.a. Molecular weight: 49537.74 Da Isoelectric Point: 9.0448
>T279004 WP_280628594.1 NZ_CP123498:c1802302-1800986 [Arsenophonus nasoniae]
MVMEVINVNYKQHEVGAVSFDTSKGLGFFEYNSRFIKQGIELSPLKMPLATRIYSFPELDFNTFKGLPGLIADSLPDDFG
NAVLNAWVATMGKSPDTITPLQRLQYTGKRGMGALEYVPATRIKSLNASQQVEISSLVAITQEILDSRQKFTVELHKNGQ
EDREAMMALLSVGMSAGGARPKAVLAFNQDFTQVRSGQTNVPDGFTHYLIKFDGVSEHNKNQQTFGDPVGFGAMEYVYYL
LATRCGIEMMPCRLLAEGNRRHFITQRFDRFGNKKRHVQTLNGLAHVDYKKPGSFSYAELFGVARQLKLSAKEAEQLLKR
MTFNIVARNHDDHAKNFSFMLKGDKWMLAPAYDLAYSYKPGSKWVNSHWMSLNGKRDNFSRQDFYSLEKLSPLFTREMIN
GIIDETIEKVSEWQKLAVEFAVPNLLAQEINANLCLNI
MVMEVINVNYKQHEVGAVSFDTSKGLGFFEYNSRFIKQGIELSPLKMPLATRIYSFPELDFNTFKGLPGLIADSLPDDFG
NAVLNAWVATMGKSPDTITPLQRLQYTGKRGMGALEYVPATRIKSLNASQQVEISSLVAITQEILDSRQKFTVELHKNGQ
EDREAMMALLSVGMSAGGARPKAVLAFNQDFTQVRSGQTNVPDGFTHYLIKFDGVSEHNKNQQTFGDPVGFGAMEYVYYL
LATRCGIEMMPCRLLAEGNRRHFITQRFDRFGNKKRHVQTLNGLAHVDYKKPGSFSYAELFGVARQLKLSAKEAEQLLKR
MTFNIVARNHDDHAKNFSFMLKGDKWMLAPAYDLAYSYKPGSKWVNSHWMSLNGKRDNFSRQDFYSLEKLSPLFTREMIN
GIIDETIEKVSEWQKLAVEFAVPNLLAQEINANLCLNI
Download Length: 1317 bp