Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 1458541..1459135 | Replicon | chromosome |
| Accession | NZ_CP123498 | ||
| Organism | Arsenophonus nasoniae strain aIh | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | QE207_RS09070 | Protein ID | WP_280630101.1 |
| Coordinates | 1458541..1458858 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QE207_RS09075 | Protein ID | WP_280630102.1 |
| Coordinates | 1458848..1459135 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE207_RS09045 (QE207_09040) | 1454610..1455911 | - | 1302 | WP_280630096.1 | phage tail protein | - |
| QE207_RS09050 (QE207_09045) | 1455908..1456519 | - | 612 | WP_280630097.1 | phage tail protein I | - |
| QE207_RS09055 (QE207_09050) | 1456509..1457420 | - | 912 | WP_280630098.1 | baseplate J/gp47 family protein | - |
| QE207_RS09060 (QE207_09055) | 1457424..1457765 | - | 342 | WP_280630099.1 | GPW/gp25 family protein | - |
| QE207_RS09065 (QE207_09060) | 1457762..1458385 | - | 624 | WP_280630100.1 | phage baseplate assembly protein V | - |
| QE207_RS09070 (QE207_09065) | 1458541..1458858 | + | 318 | WP_280630101.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QE207_RS09075 (QE207_09070) | 1458848..1459135 | + | 288 | WP_280630102.1 | putative addiction module antidote protein | Antitoxin |
| QE207_RS09080 (QE207_09075) | 1459140..1459769 | - | 630 | WP_280630103.1 | phage virion morphogenesis protein | - |
| QE207_RS09085 (QE207_09080) | 1459766..1460191 | - | 426 | WP_280630104.1 | phage tail protein | - |
| QE207_RS09090 (QE207_09085) | 1460175..1460297 | - | 123 | WP_280630105.1 | hypothetical protein | - |
| QE207_RS09095 (QE207_09090) | 1460326..1460718 | - | 393 | WP_280630106.1 | hypothetical protein | - |
| QE207_RS09100 (QE207_09095) | 1460715..1461131 | - | 417 | WP_280630107.1 | structural protein | - |
| QE207_RS09105 (QE207_09100) | 1461124..1461435 | - | 312 | WP_280630108.1 | phage holin family protein | - |
| QE207_RS09110 (QE207_09105) | 1461438..1461641 | - | 204 | WP_280630109.1 | tail protein X | - |
| QE207_RS09115 (QE207_09110) | 1461638..1462105 | - | 468 | WP_280630110.1 | head completion/stabilization protein | - |
| QE207_RS09120 (QE207_09115) | 1462192..1462851 | - | 660 | WP_280630111.1 | phage terminase small subunit | - |
| QE207_RS09125 (QE207_09120) | 1462854..1463981 | - | 1128 | WP_280630112.1 | phage major capsid protein, P2 family | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1448078..1500008 | 51930 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11987.83 Da Isoelectric Point: 9.8896
>T279002 WP_280630101.1 NZ_CP123498:1458541-1458858 [Arsenophonus nasoniae]
MKERKLKQTAVFHAWESKLRDRRARTLIATRLFRLANGLAGDVMPVGEGISELRIHYGPGYRIYFQQRGDTIIVLLCGGD
KSTQSNDILLAKKLAKEWIDEVNDD
MKERKLKQTAVFHAWESKLRDRRARTLIATRLFRLANGLAGDVMPVGEGISELRIHYGPGYRIYFQQRGDTIIVLLCGGD
KSTQSNDILLAKKLAKEWIDEVNDD
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|