Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
Location | 2086996..2087329 | Replicon | chromosome |
Accession | NC_018002 | ||
Organism | Sulfurospirillum barnesii SES-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | SULBA_RS12885 | Protein ID | WP_156790578.1 |
Coordinates | 2086996..2087178 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | SULBA_RS12975 | Protein ID | WP_156790539.1 |
Coordinates | 2087162..2087329 (-) | Length | 56 a.a. |
Genomic Context
Location: 2082536..2083546 (1011 bp)
Type: Others
Protein ID: WP_014770259.1
Type: Others
Protein ID: WP_014770259.1
Location: 2085434..2086258 (825 bp)
Type: Others
Protein ID: WP_083834418.1
Type: Others
Protein ID: WP_083834418.1
Location: 2086452..2086826 (375 bp)
Type: Others
Protein ID: WP_014770261.1
Type: Others
Protein ID: WP_014770261.1
Location: 2087510..2087986 (477 bp)
Type: Others
Protein ID: WP_014770262.1
Type: Others
Protein ID: WP_014770262.1
Location: 2088124..2088942 (819 bp)
Type: Others
Protein ID: WP_014770263.1
Type: Others
Protein ID: WP_014770263.1
Location: 2088950..2089615 (666 bp)
Type: Others
Protein ID: WP_156790579.1
Type: Others
Protein ID: WP_156790579.1
Location: 2089612..2090322 (711 bp)
Type: Others
Protein ID: WP_014770265.1
Type: Others
Protein ID: WP_014770265.1
Location: 2090312..2090761 (450 bp)
Type: Others
Protein ID: WP_041671850.1
Type: Others
Protein ID: WP_041671850.1
Location: 2090754..2091773 (1020 bp)
Type: Others
Protein ID: WP_014770266.1
Type: Others
Protein ID: WP_014770266.1
Location: 2083687..2084889 (1203 bp)
Type: Others
Protein ID: WP_014768976.1
Type: Others
Protein ID: WP_014768976.1
Location: 2086996..2087178 (183 bp)
Type: Toxin
Protein ID: WP_156790578.1
Type: Toxin
Protein ID: WP_156790578.1
Location: 2087162..2087329 (168 bp)
Type: Antitoxin
Protein ID: WP_156790539.1
Type: Antitoxin
Protein ID: WP_156790539.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SULBA_RS10460 | 2082536..2083546 | + | 1011 | WP_014770259.1 | hypothetical protein | - |
SULBA_RS10465 | 2083687..2084889 | - | 1203 | WP_014768976.1 | IS256 family transposase | - |
SULBA_RS12810 | 2085434..2086258 | + | 825 | WP_083834418.1 | signal peptidase I | - |
SULBA_RS10475 | 2086452..2086826 | + | 375 | WP_014770261.1 | hypothetical protein | - |
SULBA_RS12885 | 2086996..2087178 | - | 183 | WP_156790578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SULBA_RS12975 | 2087162..2087329 | - | 168 | WP_156790539.1 | hypothetical protein | Antitoxin |
SULBA_RS10480 | 2087510..2087986 | + | 477 | WP_014770262.1 | glutathione peroxidase | - |
SULBA_RS10485 | 2088124..2088942 | + | 819 | WP_014770263.1 | sirohydrochlorin cobaltochelatase | - |
SULBA_RS10490 | 2088950..2089615 | + | 666 | WP_156790579.1 | cobalt-precorrin-2 C(20)-methyltransferase | - |
SULBA_RS10495 | 2089612..2090322 | + | 711 | WP_014770265.1 | precorrin-8X methylmutase | - |
SULBA_RS10500 | 2090312..2090761 | + | 450 | WP_041671850.1 | (2Fe-2S) ferredoxin domain-containing protein | - |
SULBA_RS10505 | 2090754..2091773 | + | 1020 | WP_014770266.1 | cobalt-precorrin-5B (C(1))-methyltransferase CbiD | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7245.42 Da Isoelectric Point: 10.2553
>T27900 WP_156790578.1 NC_018002:c2087178-2086996 [Sulfurospirillum barnesii SES-3]
IKHLSDCTDPRDKGKKRKGKLKEFWRYRVGDYRIITKITDQEITILVLKVAHRKDVYEDQ
IKHLSDCTDPRDKGKKRKGKLKEFWRYRVGDYRIITKITDQEITILVLKVAHRKDVYEDQ
Download Length: 183 bp
>T27900 NC_018002:c2087178-2086996 [Sulfurospirillum barnesii SES-3]
ATCAAACACCTGAGTGACTGTACTGACCCAAGAGACAAAGGCAAGAAACGCAAAGGCAAACTCAAAGAATTTTGGCGATA
TAGAGTAGGCGATTATCGCATCATTACCAAAATCACCGATCAAGAAATCACGATTTTAGTTTTGAAGGTGGCGCATCGAA
AAGATGTGTATGAGGATCAGTAA
ATCAAACACCTGAGTGACTGTACTGACCCAAGAGACAAAGGCAAGAAACGCAAAGGCAAACTCAAAGAATTTTGGCGATA
TAGAGTAGGCGATTATCGCATCATTACCAAAATCACCGATCAAGAAATCACGATTTTAGTTTTGAAGGTGGCGCATCGAA
AAGATGTGTATGAGGATCAGTAA
Antitoxin
Download Length: 56 a.a. Molecular weight: 6598.36 Da Isoelectric Point: 4.3308
>AT27900 WP_156790539.1 NC_018002:c2087329-2087162 [Sulfurospirillum barnesii SES-3]
MATSIRLDDSFEARLTRLATLTDRPKSFYIRKLFEDYFENLEDYYLAEKADQTPE
MATSIRLDDSFEARLTRLATLTDRPKSFYIRKLFEDYFENLEDYYLAEKADQTPE
Download Length: 168 bp
>AT27900 NC_018002:c2087329-2087162 [Sulfurospirillum barnesii SES-3]
ATGGCTACTTCTATTAGACTCGATGATAGTTTTGAAGCACGATTGACTCGGTTAGCAACCTTAACAGATCGTCCAAAATC
TTTTTATATTAGAAAGTTGTTTGAAGATTATTTTGAGAATTTGGAAGATTATTATTTAGCAGAAAAAGCAGATCAAACAC
CTGAGTGA
ATGGCTACTTCTATTAGACTCGATGATAGTTTTGAAGCACGATTGACTCGGTTAGCAACCTTAACAGATCGTCCAAAATC
TTTTTATATTAGAAAGTTGTTTGAAGATTATTTTGAGAATTTGGAAGATTATTATTTAGCAGAAAAAGCAGATCAAACAC
CTGAGTGA