Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 544814..545396 | Replicon | chromosome |
Accession | NZ_CP123498 | ||
Organism | Arsenophonus nasoniae strain aIh |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QE207_RS04460 | Protein ID | WP_280629590.1 |
Coordinates | 545100..545396 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QE207_RS04455 | Protein ID | WP_280629589.1 |
Coordinates | 544814..545098 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE207_RS04430 (QE207_04425) | 540184..541224 | - | 1041 | WP_280628258.1 | IS21 family transposase | - |
QE207_RS04435 (QE207_04430) | 541314..542264 | + | 951 | Protein_475 | helix-turn-helix domain-containing protein | - |
QE207_RS04440 (QE207_04435) | 542273..542413 | + | 141 | WP_280629587.1 | hypothetical protein | - |
QE207_RS04445 (QE207_04440) | 542547..543230 | + | 684 | Protein_477 | IS6 family transposase | - |
QE207_RS04450 (QE207_04445) | 543253..544530 | - | 1278 | WP_280629588.1 | SMEK domain-containing protein | - |
QE207_RS04455 (QE207_04450) | 544814..545098 | - | 285 | WP_280629589.1 | putative addiction module antidote protein | Antitoxin |
QE207_RS04460 (QE207_04455) | 545100..545396 | - | 297 | WP_280629590.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QE207_RS04465 (QE207_04460) | 546076..546759 | + | 684 | Protein_481 | IS6 family transposase | - |
QE207_RS04470 (QE207_04465) | 547293..547562 | - | 270 | WP_280629591.1 | hypothetical protein | - |
QE207_RS04475 (QE207_04470) | 547576..550359 | + | 2784 | WP_280629592.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 520832..595437 | 74605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11254.13 Da Isoelectric Point: 10.1687
>T278998 WP_280629590.1 NZ_CP123498:c545396-545100 [Arsenophonus nasoniae]
MIEIRQTEEVKKWLKGLKDKIAKAKILTRIERMKEGNYGDVEPIGDGYSELKIHQGKGYRVYFATRNNEIILLLCGGDKA
TQQADIKKAKQIAKQWGF
MIEIRQTEEVKKWLKGLKDKIAKAKILTRIERMKEGNYGDVEPIGDGYSELKIHQGKGYRVYFATRNNEIILLLCGGDKA
TQQADIKKAKQIAKQWGF
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|