Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 51510..52146 | Replicon | plasmid paIh2 |
Accession | NZ_CP123492 | ||
Organism | Arsenophonus nasoniae strain aIh |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QE207_RS00915 | Protein ID | WP_280628348.1 |
Coordinates | 51510..51686 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QE207_RS00920 | Protein ID | WP_280628349.1 |
Coordinates | 51736..52146 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE207_RS00885 (QE207_00885) | 46606..47805 | + | 1200 | WP_280624651.1 | IS91 family transposase | - |
QE207_RS00890 (QE207_00890) | 48119..49395 | + | 1277 | Protein_52 | cytosine permease | - |
QE207_RS00895 (QE207_00895) | 49647..49865 | - | 219 | WP_280628306.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
QE207_RS00900 (QE207_00900) | 49858..50112 | - | 255 | WP_280628307.1 | hypothetical protein | - |
QE207_RS00905 (QE207_00905) | 50109..50651 | - | 543 | WP_280628308.1 | hypothetical protein | - |
QE207_RS00910 (QE207_00910) | 50783..51295 | - | 513 | WP_280628309.1 | J domain-containing protein | - |
QE207_RS00915 (QE207_00915) | 51510..51686 | + | 177 | WP_280628348.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QE207_RS00920 (QE207_00920) | 51736..52146 | + | 411 | WP_280628349.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QE207_RS00925 (QE207_00925) | 52532..53293 | - | 762 | WP_280628310.1 | IS21-like element helper ATPase IstB | - |
QE207_RS00930 (QE207_00930) | 53280..54056 | - | 777 | Protein_60 | IS21 family transposase | - |
QE207_RS00935 (QE207_00935) | 54088..57117 | - | 3030 | WP_280628311.1 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..64846 | 64846 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6709.83 Da Isoelectric Point: 11.6882
>T278997 WP_280628348.1 NZ_CP123492:51510-51686 [Arsenophonus nasoniae]
VKQSEFRRWLEAQGVEISNGTNHLKLRFNGKRSVMPRHPSAEIKEPTRKAILKQLGLK
VKQSEFRRWLEAQGVEISNGTNHLKLRFNGKRSVMPRHPSAEIKEPTRKAILKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15150.46 Da Isoelectric Point: 5.2431
>AT278997 WP_280628349.1 NZ_CP123492:51736-52146 [Arsenophonus nasoniae]
MRYPVNLTACKEGGFSVTFPDIPEAITQGENREEALKMALDALVTAFEFYFEDNEAIPAPSPVRADFVEVPAAVVAKVLL
LNQFAKSEMSQSELARRMHCPRQEVTRLFDLKHNTKINTVQKALAVLGQRLELSVA
MRYPVNLTACKEGGFSVTFPDIPEAITQGENREEALKMALDALVTAFEFYFEDNEAIPAPSPVRADFVEVPAAVVAKVLL
LNQFAKSEMSQSELARRMHCPRQEVTRLFDLKHNTKINTVQKALAVLGQRLELSVA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|