Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4017653..4018356 | Replicon | chromosome |
Accession | NZ_CP123488 | ||
Organism | Kluyvera intermedia strain DW18 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | QBD33_RS19325 | Protein ID | WP_275388215.1 |
Coordinates | 4017653..4017994 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QBD33_RS19330 | Protein ID | WP_275388216.1 |
Coordinates | 4018015..4018356 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBD33_RS19315 (4015392) | 4015392..4016036 | - | 645 | Protein_3777 | integrase arm-type DNA-binding domain-containing protein | - |
QBD33_RS19320 (4016382) | 4016382..4017389 | - | 1008 | WP_275388214.1 | restriction endonuclease | - |
QBD33_RS19325 (4017653) | 4017653..4017994 | - | 342 | WP_275388215.1 | TA system toxin CbtA family protein | Toxin |
QBD33_RS19330 (4018015) | 4018015..4018356 | - | 342 | WP_275388216.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QBD33_RS19335 (4018367) | 4018367..4018909 | - | 543 | WP_275388217.1 | DNA repair protein RadC | - |
QBD33_RS19340 (4018922) | 4018922..4019398 | - | 477 | WP_275388218.1 | antirestriction protein | - |
QBD33_RS19345 (4019642) | 4019642..4020460 | - | 819 | WP_275388219.1 | DUF932 domain-containing protein | - |
QBD33_RS19350 (4020670) | 4020670..4021296 | - | 627 | WP_275388220.1 | hypothetical protein | - |
QBD33_RS19355 (4021301) | 4021301..4021852 | - | 552 | WP_275388221.1 | hypothetical protein | - |
QBD33_RS19360 (4022158) | 4022158..4023039 | - | 882 | WP_275388222.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4014180..4021852 | 7672 | |
- | inside | Prophage | - | - | 4004487..4039807 | 35320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12827.80 Da Isoelectric Point: 9.8952
>T278995 WP_275388215.1 NZ_CP123488:c4017994-4017653 [Kluyvera intermedia]
MKTLSATTPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQKHIDTGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAVR
MKTLSATTPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQKHIDTGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|