Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3470348..3470966 | Replicon | chromosome |
| Accession | NZ_CP123488 | ||
| Organism | Kluyvera intermedia strain DW18 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A447MKF0 |
| Locus tag | QBD33_RS16835 | Protein ID | WP_062773821.1 |
| Coordinates | 3470748..3470966 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | QBD33_RS16830 | Protein ID | WP_280556207.1 |
| Coordinates | 3470348..3470722 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBD33_RS16820 (3465427) | 3465427..3468573 | + | 3147 | WP_280556206.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QBD33_RS16830 (3470348) | 3470348..3470722 | + | 375 | WP_280556207.1 | Hha toxicity modulator TomB | Antitoxin |
| QBD33_RS16835 (3470748) | 3470748..3470966 | + | 219 | WP_062773821.1 | HHA domain-containing protein | Toxin |
| QBD33_RS16840 (3471107) | 3471107..3471661 | + | 555 | WP_062773823.1 | maltose O-acetyltransferase | - |
| QBD33_RS16845 (3471765) | 3471765..3472235 | + | 471 | WP_280556208.1 | YlaC family protein | - |
| QBD33_RS16850 (3472210) | 3472210..3473655 | - | 1446 | WP_280556209.1 | PLP-dependent aminotransferase family protein | - |
| QBD33_RS16855 (3473758) | 3473758..3474468 | + | 711 | WP_280556211.1 | GNAT family protein | - |
| QBD33_RS16860 (3474465) | 3474465..3474605 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| QBD33_RS16865 (3474605) | 3474605..3474868 | - | 264 | WP_052283831.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8624.01 Da Isoelectric Point: 8.9008
>T278994 WP_062773821.1 NZ_CP123488:3470748-3470966 [Kluyvera intermedia]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPTVWKFIR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPTVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14310.11 Da Isoelectric Point: 5.5770
>AT278994 WP_280556207.1 NZ_CP123488:3470348-3470722 [Kluyvera intermedia]
MDEYSPKRHDIAQLKFLCETLYHDSLATLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYSKDNKLIAQIDEYL
DDTFMLFGNYGVNSDDLQKWRKSGNKLFRCFVNASRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDSLATLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYSKDNKLIAQIDEYL
DDTFMLFGNYGVNSDDLQKWRKSGNKLFRCFVNASRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|