Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 858935..859598 | Replicon | chromosome |
| Accession | NZ_CP123488 | ||
| Organism | Kluyvera intermedia strain DW18 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3S4EYA3 |
| Locus tag | QBD33_RS04145 | Protein ID | WP_062773047.1 |
| Coordinates | 859182..859598 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A3S4FV25 |
| Locus tag | QBD33_RS04140 | Protein ID | WP_062773044.1 |
| Coordinates | 858935..859201 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBD33_RS04115 (854090) | 854090..855523 | - | 1434 | WP_280557625.1 | 6-phospho-beta-glucosidase BglA | - |
| QBD33_RS04120 (855644) | 855644..856330 | - | 687 | WP_062773031.1 | MurR/RpiR family transcriptional regulator | - |
| QBD33_RS04125 (856424) | 856424..856738 | + | 315 | WP_280557626.1 | N(4)-acetylcytidine aminohydrolase | - |
| QBD33_RS04130 (856897) | 856897..857559 | + | 663 | WP_280557628.1 | hemolysin III family protein | - |
| QBD33_RS04135 (857704) | 857704..858687 | - | 984 | WP_153742213.1 | tRNA-modifying protein YgfZ | - |
| QBD33_RS04140 (858935) | 858935..859201 | + | 267 | WP_062773044.1 | FAD assembly factor SdhE | Antitoxin |
| QBD33_RS04145 (859182) | 859182..859598 | + | 417 | WP_062773047.1 | protein YgfX | Toxin |
| QBD33_RS04150 (859595) | 859595..860116 | - | 522 | WP_280558770.1 | flavodoxin FldB | - |
| QBD33_RS04155 (860219) | 860219..861115 | + | 897 | WP_062773053.1 | site-specific tyrosine recombinase XerD | - |
| QBD33_RS04160 (861137) | 861137..861850 | + | 714 | WP_280557636.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QBD33_RS04165 (861856) | 861856..863589 | + | 1734 | WP_062773059.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16416.32 Da Isoelectric Point: 11.6889
>T278989 WP_062773047.1 NZ_CP123488:859182-859598 [Kluyvera intermedia]
VVLWQSDLRVSWRSQWLSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSLVVFDCVRSQRRIHSHQGEIKLLMDSRLRWRNQ
EWDILGTPWMLSSGMMLRIRRCDGGRRQHLWLAADSMNAQEWRDLRRILLQQPAPGQH
VVLWQSDLRVSWRSQWLSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSLVVFDCVRSQRRIHSHQGEIKLLMDSRLRWRNQ
EWDILGTPWMLSSGMMLRIRRCDGGRRQHLWLAADSMNAQEWRDLRRILLQQPAPGQH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S4EYA3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S4FV25 |