Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5864..6389 Replicon plasmid pYUSHP16-2
Accession NZ_CP123432
Organism Klebsiella pneumoniae strain SH22PE16

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag QEZ34_RS25935 Protein ID WP_013023785.1
Coordinates 5864..6169 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag QEZ34_RS25940 Protein ID WP_001568025.1
Coordinates 6171..6389 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEZ34_RS25905 1567..2193 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
QEZ34_RS25910 2190..2492 + 303 WP_004197636.1 hypothetical protein -
QEZ34_RS25915 2940..3734 - 795 WP_004197635.1 site-specific integrase -
QEZ34_RS25920 3932..4948 - 1017 WP_017899884.1 hypothetical protein -
QEZ34_RS25925 4959..5273 - 315 WP_053389906.1 hypothetical protein -
QEZ34_RS25930 5300..5695 - 396 WP_017899885.1 hypothetical protein -
QEZ34_RS25935 5864..6169 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
QEZ34_RS25940 6171..6389 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QEZ34_RS25945 7207..7497 - 291 WP_013023783.1 hypothetical protein -
QEZ34_RS25950 7494..8621 - 1128 WP_013023782.1 DUF4238 domain-containing protein -
QEZ34_RS25955 8655..10178 - 1524 WP_017899887.1 hypothetical protein -
QEZ34_RS25960 10454..11233 - 780 WP_280166008.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / aac(3)-IId / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / qnrB91 / mph(A) / tet(A) / floR / blaTEM-1B / blaCTX-M-3 - 1..139452 139452


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T278988 WP_013023785.1 NZ_CP123432:c6169-5864 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT278988 WP_001568025.1 NZ_CP123432:c6389-6171 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References