Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 124285..124928 | Replicon | plasmid pYUSHP16-1 |
Accession | NZ_CP123431 | ||
Organism | Klebsiella pneumoniae strain SH22PE16 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A155IU92 |
Locus tag | QEZ34_RS25435 | Protein ID | WP_000754567.1 |
Coordinates | 124512..124928 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A853H7M9 |
Locus tag | QEZ34_RS25430 | Protein ID | WP_001261275.1 |
Coordinates | 124285..124515 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEZ34_RS25420 | 119987..121453 | + | 1467 | Protein_123 | AAA family ATPase | - |
QEZ34_RS25425 | 121456..124032 | + | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
QEZ34_RS25430 | 124285..124515 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QEZ34_RS25435 | 124512..124928 | + | 417 | WP_000754567.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEZ34_RS25440 | 125109..126128 | - | 1020 | WP_064160291.1 | fimbrial protein | - |
QEZ34_RS25445 | 126149..128542 | - | 2394 | WP_064163930.1 | fimbria/pilus outer membrane usher protein | - |
QEZ34_RS25450 | 128554..129249 | - | 696 | WP_064160295.1 | molecular chaperone | - |
QEZ34_RS25455 | 129308..129877 | - | 570 | WP_064160296.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / sul2 | pla | 1..218903 | 218903 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15108.61 Da Isoelectric Point: 8.5403
>T278986 WP_000754567.1 NZ_CP123431:124512-124928 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A155IU92 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A853H7M9 |