Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1010139..1010737 | Replicon | chromosome |
| Accession | NZ_CP123403 | ||
| Organism | Trueperella pyogenes strain 13OD0707 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | QEV10_RS04370 | Protein ID | WP_108726552.1 |
| Coordinates | 1010423..1010737 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QEV10_RS04365 | Protein ID | WP_108726551.1 |
| Coordinates | 1010139..1010432 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEV10_RS04335 (QEV10_04335) | 1005569..1006216 | - | 648 | WP_039661760.1 | 5-formyltetrahydrofolate cyclo-ligase | - |
| QEV10_RS04340 (QEV10_04340) | 1006300..1007514 | + | 1215 | WP_039661762.1 | molybdopterin molybdotransferase MoeA | - |
| QEV10_RS04345 (QEV10_04345) | 1007574..1008593 | + | 1020 | WP_283839989.1 | hypothetical protein | - |
| QEV10_RS04350 (QEV10_04350) | 1008590..1009216 | + | 627 | WP_108726549.1 | alpha/beta fold hydrolase | - |
| QEV10_RS04360 (QEV10_04360) | 1009616..1010032 | - | 417 | WP_108726550.1 | SRPBCC family protein | - |
| QEV10_RS04365 (QEV10_04365) | 1010139..1010432 | - | 294 | WP_108726551.1 | putative addiction module antidote protein | Antitoxin |
| QEV10_RS04370 (QEV10_04370) | 1010423..1010737 | - | 315 | WP_108726552.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QEV10_RS04375 (QEV10_04375) | 1011130..1011915 | + | 786 | WP_260145384.1 | siderophore-interacting protein | - |
| QEV10_RS04380 (QEV10_04380) | 1012243..1012599 | + | 357 | WP_039661774.1 | hypothetical protein | - |
| QEV10_RS04385 (QEV10_04385) | 1012731..1013354 | - | 624 | WP_230589887.1 | alpha/beta hydrolase | - |
| QEV10_RS04390 (QEV10_04390) | 1013486..1014439 | - | 954 | WP_108726554.1 | SRPBCC family protein | - |
| QEV10_RS04395 (QEV10_04395) | 1014436..1014678 | - | 243 | WP_024963636.1 | hypothetical protein | - |
| QEV10_RS04400 (QEV10_04400) | 1014787..1015704 | + | 918 | WP_283839991.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 998989..1013354 | 14365 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11875.76 Da Isoelectric Point: 10.0302
>T278972 WP_108726552.1 NZ_CP123403:c1010737-1010423 [Trueperella pyogenes]
VKIRQTDVYAHWFRELKDVQSKARINIALQRCKIAGEVVGDVKPVGDGVFEMRIHVGPGYRIYYMSRGNQLMLLVIGGDK
STQQRDITKAKQLATEIIREGSWE
VKIRQTDVYAHWFRELKDVQSKARINIALQRCKIAGEVVGDVKPVGDGVFEMRIHVGPGYRIYYMSRGNQLMLLVIGGDK
STQQRDITKAKQLATEIIREGSWE
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|