Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 2917637..2918199 | Replicon | chromosome |
Accession | NZ_CP123381 | ||
Organism | Gordonia sp. SMJS1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A6G7W718 |
Locus tag | QAD21_RS13385 | Protein ID | WP_055477308.1 |
Coordinates | 2917637..2917927 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A6G7W6R5 |
Locus tag | QAD21_RS13390 | Protein ID | WP_055477309.1 |
Coordinates | 2917924..2918199 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAD21_RS13365 (QAD21_13365) | 2913588..2915648 | + | 2061 | WP_068970440.1 | DEAD/DEAH box helicase family protein | - |
QAD21_RS13370 (QAD21_13370) | 2915683..2915922 | + | 240 | WP_055477305.1 | hypothetical protein | - |
QAD21_RS13375 (QAD21_13375) | 2916511..2916744 | + | 234 | WP_055477307.1 | hypothetical protein | - |
QAD21_RS13380 (QAD21_13380) | 2917412..2917618 | + | 207 | WP_055477311.1 | hypothetical protein | - |
QAD21_RS13385 (QAD21_13385) | 2917637..2917927 | - | 291 | WP_055477308.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QAD21_RS13390 (QAD21_13390) | 2917924..2918199 | - | 276 | WP_055477309.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QAD21_RS13395 (QAD21_13395) | 2918319..2918939 | - | 621 | WP_223258858.1 | TetR/AcrR family transcriptional regulator | - |
QAD21_RS13400 (QAD21_13400) | 2918936..2919463 | - | 528 | WP_065631669.1 | GNAT family N-acetyltransferase | - |
QAD21_RS13405 (QAD21_13405) | 2919871..2920632 | + | 762 | WP_139104661.1 | hypothetical protein | - |
QAD21_RS13410 (QAD21_13410) | 2920687..2920992 | + | 306 | WP_280359662.1 | hypothetical protein | - |
QAD21_RS13415 (QAD21_13415) | 2921044..2921424 | - | 381 | WP_065631666.1 | SRPBCC family protein | - |
QAD21_RS13420 (QAD21_13420) | 2921573..2922478 | - | 906 | WP_065631665.1 | RNA polymerase sigma-70 factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10938.40 Da Isoelectric Point: 9.7360
>T278970 WP_055477308.1 NZ_CP123381:c2917927-2917637 [Gordonia sp. SMJS1]
MSDAPTDSSAPYRVEVASPARRDLQRLPSRIVHAVIEFISGPLAENPHRLSKPLRDDLADLHSARRGDYRILLRIDDPNH
TIVIVRIDHRAHAYRT
MSDAPTDSSAPYRVEVASPARRDLQRLPSRIVHAVIEFISGPLAENPHRLSKPLRDDLADLHSARRGDYRILLRIDDPNH
TIVIVRIDHRAHAYRT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6G7W718 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6G7W6R5 |