Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PHD(antitoxin) |
Location | 1266194..1266867 | Replicon | chromosome |
Accession | NZ_CP123381 | ||
Organism | Gordonia sp. SMJS1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QAD21_RS05770 | Protein ID | WP_280360757.1 |
Coordinates | 1266463..1266867 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QAD21_RS05765 | Protein ID | WP_280360756.1 |
Coordinates | 1266194..1266466 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAD21_RS05745 (QAD21_05745) | 1261298..1261879 | - | 582 | WP_058251656.1 | TetR/AcrR family transcriptional regulator | - |
QAD21_RS05750 (QAD21_05750) | 1261954..1262935 | + | 982 | Protein_1129 | LLM class F420-dependent oxidoreductase | - |
QAD21_RS05755 (QAD21_05755) | 1263118..1264284 | - | 1167 | WP_280360752.1 | pyridoxal phosphate-dependent aminotransferase | - |
QAD21_RS05760 (QAD21_05760) | 1264382..1266061 | + | 1680 | WP_280360754.1 | protein kinase | - |
QAD21_RS05765 (QAD21_05765) | 1266194..1266466 | + | 273 | WP_280360756.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QAD21_RS05770 (QAD21_05770) | 1266463..1266867 | + | 405 | WP_280360757.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QAD21_RS05775 (QAD21_05775) | 1266869..1268545 | - | 1677 | WP_065631752.1 | DEAD/DEAH box helicase | - |
QAD21_RS05780 (QAD21_05780) | 1268612..1269541 | - | 930 | WP_280360780.1 | oxygenase MpaB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14170.42 Da Isoelectric Point: 5.1057
>T278969 WP_280360757.1 NZ_CP123381:1266463-1266867 [Gordonia sp. SMJS1]
MIYLDTAAMVKLVVREAETAQLIEWLALHPGVPTVTSALGRVELMRTALRDGSPGLHERARVLLDALDVIPLSVTVIDIA
ESIGPSSLRSLDALHLASASVIRAEMSAFVAYDHRLLAGASTLGYPTVAPGAES
MIYLDTAAMVKLVVREAETAQLIEWLALHPGVPTVTSALGRVELMRTALRDGSPGLHERARVLLDALDVIPLSVTVIDIA
ESIGPSSLRSLDALHLASASVIRAEMSAFVAYDHRLLAGASTLGYPTVAPGAES
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|