Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 17266..17843 Replicon plasmid p15758B_210
Accession NZ_CP123369
Organism Providencia rettgeri strain PreM15758

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag KOL64_RS20085 Protein ID WP_283656819.1
Coordinates 17266..17598 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag KOL64_RS20090 Protein ID WP_096864992.1
Coordinates 17598..17843 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KOL64_RS20050 (KOL64_20315) 13110..13925 - 816 WP_283656823.1 DUF4365 domain-containing protein -
KOL64_RS20055 (KOL64_20320) 13941..14894 - 954 WP_283656822.1 site-specific integrase -
KOL64_RS20060 (KOL64_20325) 15188..15481 + 294 WP_283658080.1 hypothetical protein -
KOL64_RS20065 (KOL64_20330) 15496..15750 + 255 WP_283656821.1 hypothetical protein -
KOL64_RS20070 (KOL64_20335) 15846..16304 + 459 WP_283656820.1 hypothetical protein -
KOL64_RS20075 (KOL64_20340) 16625..16768 + 144 WP_071547955.1 Hok/Gef family protein -
KOL64_RS20080 (KOL64_20345) 16855..17235 - 381 WP_096864991.1 hypothetical protein -
KOL64_RS20085 (KOL64_20350) 17266..17598 - 333 WP_283656819.1 endoribonuclease MazF Toxin
KOL64_RS20090 (KOL64_20355) 17598..17843 - 246 WP_096864992.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
KOL64_RS20095 (KOL64_20360) 18178..18801 + 624 WP_023159958.1 AAA family ATPase -
KOL64_RS20100 (KOL64_20365) 18910..19137 + 228 WP_283656818.1 plasmid partition protein ParG -
KOL64_RS20105 (KOL64_20370) 19235..19603 - 369 WP_283656817.1 hypothetical protein -
KOL64_RS20110 (KOL64_20375) 20362..20940 - 579 WP_048822182.1 hypothetical protein -
KOL64_RS20115 (KOL64_20380) 20949..21428 - 480 WP_048821772.1 Hcp family type VI secretion system effector -
KOL64_RS20120 (KOL64_20385) 21708..22100 - 393 WP_283656816.1 hypothetical protein -
KOL64_RS20125 (KOL64_20390) 22110..22532 - 423 WP_283656815.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaNDM-1 / aph(3')-VI / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / aph(3')-Ia / qnrD1 groEL 1..209862 209862


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12083.81 Da        Isoelectric Point: 6.4472

>T278965 WP_283656819.1 NZ_CP123369:c17598-17266 [Providencia rettgeri]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARNVTKKGKVEASELAEIKAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8800.23 Da        Isoelectric Point: 5.0508

>AT278965 WP_096864992.1 NZ_CP123369:c17843-17598 [Providencia rettgeri]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLENLLAGITPENIHEKVDFGARTGKEL
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References