Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 17266..17843 | Replicon | plasmid p15758B_210 |
| Accession | NZ_CP123369 | ||
| Organism | Providencia rettgeri strain PreM15758 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | KOL64_RS20085 | Protein ID | WP_283656819.1 |
| Coordinates | 17266..17598 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | KOL64_RS20090 | Protein ID | WP_096864992.1 |
| Coordinates | 17598..17843 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KOL64_RS20050 (KOL64_20315) | 13110..13925 | - | 816 | WP_283656823.1 | DUF4365 domain-containing protein | - |
| KOL64_RS20055 (KOL64_20320) | 13941..14894 | - | 954 | WP_283656822.1 | site-specific integrase | - |
| KOL64_RS20060 (KOL64_20325) | 15188..15481 | + | 294 | WP_283658080.1 | hypothetical protein | - |
| KOL64_RS20065 (KOL64_20330) | 15496..15750 | + | 255 | WP_283656821.1 | hypothetical protein | - |
| KOL64_RS20070 (KOL64_20335) | 15846..16304 | + | 459 | WP_283656820.1 | hypothetical protein | - |
| KOL64_RS20075 (KOL64_20340) | 16625..16768 | + | 144 | WP_071547955.1 | Hok/Gef family protein | - |
| KOL64_RS20080 (KOL64_20345) | 16855..17235 | - | 381 | WP_096864991.1 | hypothetical protein | - |
| KOL64_RS20085 (KOL64_20350) | 17266..17598 | - | 333 | WP_283656819.1 | endoribonuclease MazF | Toxin |
| KOL64_RS20090 (KOL64_20355) | 17598..17843 | - | 246 | WP_096864992.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| KOL64_RS20095 (KOL64_20360) | 18178..18801 | + | 624 | WP_023159958.1 | AAA family ATPase | - |
| KOL64_RS20100 (KOL64_20365) | 18910..19137 | + | 228 | WP_283656818.1 | plasmid partition protein ParG | - |
| KOL64_RS20105 (KOL64_20370) | 19235..19603 | - | 369 | WP_283656817.1 | hypothetical protein | - |
| KOL64_RS20110 (KOL64_20375) | 20362..20940 | - | 579 | WP_048822182.1 | hypothetical protein | - |
| KOL64_RS20115 (KOL64_20380) | 20949..21428 | - | 480 | WP_048821772.1 | Hcp family type VI secretion system effector | - |
| KOL64_RS20120 (KOL64_20385) | 21708..22100 | - | 393 | WP_283656816.1 | hypothetical protein | - |
| KOL64_RS20125 (KOL64_20390) | 22110..22532 | - | 423 | WP_283656815.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaNDM-1 / aph(3')-VI / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / aph(3')-Ia / qnrD1 | groEL | 1..209862 | 209862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12083.81 Da Isoelectric Point: 6.4472
>T278965 WP_283656819.1 NZ_CP123369:c17598-17266 [Providencia rettgeri]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARNVTKKGKVEASELAEIKAKAKALIG
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARNVTKKGKVEASELAEIKAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|