Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 8731..9311 | Replicon | plasmid p15793C_57 |
Accession | NZ_CP123368 | ||
Organism | Providencia rettgeri strain PreM15793 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | KOL65_RS21490 | Protein ID | WP_283656987.1 |
Coordinates | 8731..9066 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | KOL65_RS21495 | Protein ID | WP_283656988.1 |
Coordinates | 9066..9311 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KOL65_RS21455 (KOL65_21740) | 4085..4267 | - | 183 | WP_283656980.1 | hypothetical protein | - |
KOL65_RS21460 (KOL65_21745) | 4626..5846 | - | 1221 | WP_283656981.1 | DUF3560 domain-containing protein | - |
KOL65_RS21465 (KOL65_21750) | 6045..6341 | + | 297 | WP_283656982.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KOL65_RS21470 (KOL65_21755) | 6343..6627 | + | 285 | WP_283656983.1 | putative addiction module antidote protein | - |
KOL65_RS21475 (KOL65_21760) | 7073..7219 | + | 147 | WP_283656984.1 | Hok/Gef family protein | - |
KOL65_RS21480 (KOL65_21765) | 7287..7622 | - | 336 | WP_283656985.1 | hypothetical protein | - |
KOL65_RS21485 (KOL65_21770) | 7669..8706 | - | 1038 | WP_283656986.1 | hypothetical protein | - |
KOL65_RS21490 (KOL65_21775) | 8731..9066 | - | 336 | WP_283656987.1 | endoribonuclease MazF | Toxin |
KOL65_RS21495 (KOL65_21780) | 9066..9311 | - | 246 | WP_283656988.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
KOL65_RS21500 (KOL65_21785) | 10433..11407 | + | 975 | WP_283656989.1 | replication initiation protein | - |
KOL65_RS21505 (KOL65_21790) | 11394..12221 | + | 828 | WP_283656990.1 | GIY-YIG nuclease family protein | - |
KOL65_RS21510 (KOL65_21795) | 12356..12691 | + | 336 | WP_283656991.1 | hypothetical protein | - |
KOL65_RS21515 (KOL65_21800) | 12786..13082 | + | 297 | WP_283656992.1 | LuxR C-terminal-related transcriptional regulator | - |
KOL65_RS21520 (KOL65_21805) | 13248..13571 | + | 324 | WP_283656993.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..57581 | 57581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12078.91 Da Isoelectric Point: 7.6697
>T278964 WP_283656987.1 NZ_CP123368:c9066-8731 [Providencia rettgeri]
MVSRYVPDSGDLIWINLDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKNYPFEVELSCSGNESFALSDQVTC
VDWRARKITKKGTVSLSELAEIKAKAKALIG
MVSRYVPDSGDLIWINLDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKNYPFEVELSCSGNESFALSDQVTC
VDWRARKITKKGTVSLSELAEIKAKAKALIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|