Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 6045..6627 | Replicon | plasmid p15793C_57 |
| Accession | NZ_CP123368 | ||
| Organism | Providencia rettgeri strain PreM15793 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | KOL65_RS21465 | Protein ID | WP_283656982.1 |
| Coordinates | 6045..6341 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | KOL65_RS21470 | Protein ID | WP_283656983.1 |
| Coordinates | 6343..6627 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KOL65_RS21430 (KOL65_21715) | 1338..2123 | - | 786 | WP_283656975.1 | ParB/RepB/Spo0J family partition protein | - |
| KOL65_RS21435 (KOL65_21720) | 2190..2432 | - | 243 | WP_283656976.1 | hypothetical protein | - |
| KOL65_RS21440 (KOL65_21725) | 2511..2846 | - | 336 | WP_283656977.1 | hypothetical protein | - |
| KOL65_RS21445 (KOL65_21730) | 2940..3383 | - | 444 | WP_283656978.1 | hypothetical protein | - |
| KOL65_RS21450 (KOL65_21735) | 3485..3919 | - | 435 | WP_283656979.1 | hypothetical protein | - |
| KOL65_RS21455 (KOL65_21740) | 4085..4267 | - | 183 | WP_283656980.1 | hypothetical protein | - |
| KOL65_RS21460 (KOL65_21745) | 4626..5846 | - | 1221 | WP_283656981.1 | DUF3560 domain-containing protein | - |
| KOL65_RS21465 (KOL65_21750) | 6045..6341 | + | 297 | WP_283656982.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KOL65_RS21470 (KOL65_21755) | 6343..6627 | + | 285 | WP_283656983.1 | putative addiction module antidote protein | Antitoxin |
| KOL65_RS21475 (KOL65_21760) | 7073..7219 | + | 147 | WP_283656984.1 | Hok/Gef family protein | - |
| KOL65_RS21480 (KOL65_21765) | 7287..7622 | - | 336 | WP_283656985.1 | hypothetical protein | - |
| KOL65_RS21485 (KOL65_21770) | 7669..8706 | - | 1038 | WP_283656986.1 | hypothetical protein | - |
| KOL65_RS21490 (KOL65_21775) | 8731..9066 | - | 336 | WP_283656987.1 | endoribonuclease MazF | - |
| KOL65_RS21495 (KOL65_21780) | 9066..9311 | - | 246 | WP_283656988.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| KOL65_RS21500 (KOL65_21785) | 10433..11407 | + | 975 | WP_283656989.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..57581 | 57581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11152.05 Da Isoelectric Point: 10.2118
>T278963 WP_283656982.1 NZ_CP123368:6045-6341 [Providencia rettgeri]
MVEIKQTDEIEKWLNSLKDKIAKAKILIRIERMAEGNMGDVQPIGHGLSELRIHQGKGYRVYFGNKNNQIILLLCGGDKT
TQQADIKKAKELAKKWGF
MVEIKQTDEIEKWLNSLKDKIAKAKILIRIERMAEGNMGDVQPIGHGLSELRIHQGKGYRVYFGNKNNQIILLLCGGDKT
TQQADIKKAKELAKKWGF
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|