Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 176511..177088 Replicon plasmid p15793A_225
Accession NZ_CP123366
Organism Providencia rettgeri strain PreM15793

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag KOL65_RS20815 Protein ID WP_283656819.1
Coordinates 176756..177088 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag KOL65_RS20810 Protein ID WP_096864992.1
Coordinates 176511..176756 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KOL65_RS20775 (KOL65_21060) 171830..172252 + 423 WP_283656815.1 hypothetical protein -
KOL65_RS20780 (KOL65_21065) 172262..172654 + 393 WP_283656816.1 hypothetical protein -
KOL65_RS20785 (KOL65_21070) 172934..173413 + 480 WP_048821772.1 Hcp family type VI secretion system effector -
KOL65_RS20790 (KOL65_21075) 173422..174000 + 579 WP_048822182.1 hypothetical protein -
KOL65_RS20795 (KOL65_21080) 174759..175127 + 369 WP_283656817.1 hypothetical protein -
KOL65_RS20800 (KOL65_21085) 175225..175452 - 228 WP_283656818.1 plasmid partition protein ParG -
KOL65_RS20805 (KOL65_21090) 175561..176184 - 624 WP_023159958.1 AAA family ATPase -
KOL65_RS20810 (KOL65_21095) 176511..176756 + 246 WP_096864992.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
KOL65_RS20815 (KOL65_21100) 176756..177088 + 333 WP_283656819.1 endoribonuclease MazF Toxin
KOL65_RS20820 (KOL65_21105) 177119..177499 + 381 WP_096864991.1 hypothetical protein -
KOL65_RS20825 (KOL65_21110) 177586..177729 - 144 WP_071547955.1 Hok/Gef family protein -
KOL65_RS20830 (KOL65_21115) 178050..178508 - 459 WP_283656820.1 hypothetical protein -
KOL65_RS20835 (KOL65_21120) 178604..178858 - 255 WP_283656821.1 hypothetical protein -
KOL65_RS20840 (KOL65_21125) 179460..180413 + 954 WP_283656822.1 site-specific integrase -
KOL65_RS20845 (KOL65_21130) 180429..181244 + 816 WP_283656823.1 DUF4365 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrD1 / aph(3')-Ia / sul1 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / blaPER-2 / aph(3')-VI / blaNDM-1 groEL 1..224540 224540


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12083.81 Da        Isoelectric Point: 6.4472

>T278962 WP_283656819.1 NZ_CP123366:176756-177088 [Providencia rettgeri]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARNVTKKGKVEASELAEIKAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8800.23 Da        Isoelectric Point: 5.0508

>AT278962 WP_096864992.1 NZ_CP123366:176511-176756 [Providencia rettgeri]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLENLLAGITPENIHEKVDFGARTGKEL
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References