Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 3589632..3590263 | Replicon | chromosome |
Accession | NZ_CP123365 | ||
Organism | Shigella flexneri strain MMGSG_23 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A822PMR8 |
Locus tag | PFB08_RS18330 | Protein ID | WP_001259384.1 |
Coordinates | 3589988..3590263 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | U9Y7E1 |
Locus tag | PFB08_RS18325 | Protein ID | WP_000593555.1 |
Coordinates | 3589632..3589991 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PFB08_RS18300 (3585764) | 3585764..3586708 | + | 945 | WP_000947076.1 | nickel ABC transporter permease subunit NikB | - |
PFB08_RS18305 (3586705) | 3586705..3587538 | + | 834 | WP_001008973.1 | nickel ABC transporter permease subunit NikC | - |
PFB08_RS18310 (3587538) | 3587538..3588302 | + | 765 | WP_001136253.1 | nickel import ATP-binding protein NikD | - |
PFB08_RS18315 (3588299) | 3588299..3589105 | + | 807 | WP_000173660.1 | nickel import ATP-binding protein NikE | - |
PFB08_RS18320 (3589111) | 3589111..3589512 | + | 402 | WP_001190062.1 | nickel-responsive transcriptional regulator NikR | - |
PFB08_RS18325 (3589632) | 3589632..3589991 | - | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PFB08_RS18330 (3589988) | 3589988..3590263 | - | 276 | WP_001259384.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PFB08_RS18335 (3590322) | 3590322..3591446 | - | 1125 | WP_001216257.1 | ABC transporter permease | - |
PFB08_RS18340 (3591446) | 3591446..3594181 | - | 2736 | WP_000149173.1 | ribosome-associated ATPase/putative transporter RbbA | - |
PFB08_RS18345 (3594178) | 3594178..3595245 | - | 1068 | WP_000361470.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10146.89 Da Isoelectric Point: 10.3748
>T278959 WP_001259384.1 NZ_CP123365:c3590263-3589988 [Shigella flexneri]
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
CDWLLSIGVKP
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
CDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT278959 WP_000593555.1 NZ_CP123365:c3589991-3589632 [Shigella flexneri]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A822PMR8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LKZ6 |