Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3096689..3097490 | Replicon | chromosome |
| Accession | NZ_CP123365 | ||
| Organism | Shigella flexneri strain MMGSG_23 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D3GUT5 |
| Locus tag | PFB08_RS15790 | Protein ID | WP_001094430.1 |
| Coordinates | 3097113..3097490 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | D3GUT4 |
| Locus tag | PFB08_RS15785 | Protein ID | WP_001285620.1 |
| Coordinates | 3096689..3097066 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFB08_RS15755 (3093310) | 3093310..3093765 | + | 456 | WP_005051844.1 | IrmA family protein | - |
| PFB08_RS15760 (3093908) | 3093908..3093997 | + | 90 | WP_112031555.1 | DUF905 family protein | - |
| PFB08_RS15765 (3094176) | 3094176..3094994 | + | 819 | WP_001177758.1 | DUF932 domain-containing protein | - |
| PFB08_RS15770 (3095336) | 3095336..3095809 | + | 474 | WP_000855059.1 | antirestriction protein | - |
| PFB08_RS15775 (3095825) | 3095825..3096301 | + | 477 | WP_001387238.1 | RadC family protein | - |
| PFB08_RS15780 (3096388) | 3096388..3096609 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| PFB08_RS15785 (3096689) | 3096689..3097066 | + | 378 | WP_001285620.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PFB08_RS15790 (3097113) | 3097113..3097490 | + | 378 | WP_001094430.1 | TA system toxin CbtA family protein | Toxin |
| PFB08_RS15795 (3097487) | 3097487..3097975 | + | 489 | WP_000761715.1 | DUF5983 family protein | - |
| PFB08_RS15800 (3097995) | 3097995..3098192 | + | 198 | WP_000772029.1 | DUF957 domain-containing protein | - |
| PFB08_RS15805 (3098277) | 3098277..3099119 | + | 843 | WP_001290187.1 | DUF4942 domain-containing protein | - |
| PFB08_RS15810 (3099722) | 3099722..3100930 | + | 1209 | WP_011069512.1 | IS4-like element ISVsa5 family transposase | - |
| PFB08_RS15815 (3101234) | 3101234..3101479 | + | 246 | WP_000875412.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13971.82 Da Isoelectric Point: 6.8608
>T278957 WP_001094430.1 NZ_CP123365:3097113-3097490 [Shigella flexneri]
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13698.52 Da Isoelectric Point: 5.9505
>AT278957 WP_001285620.1 NZ_CP123365:3096689-3097066 [Shigella flexneri]
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y6M7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2INW | |
| AlphaFold DB | A0A0E0Y522 |