Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2974330..2974984 | Replicon | chromosome |
Accession | NZ_CP123365 | ||
Organism | Shigella flexneri strain MMGSG_23 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q0T101 |
Locus tag | PFB08_RS15175 | Protein ID | WP_000244767.1 |
Coordinates | 2974330..2974737 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | Q0T100 |
Locus tag | PFB08_RS15180 | Protein ID | WP_000354044.1 |
Coordinates | 2974718..2974984 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PFB08_RS15155 (2970287) | 2970287..2972020 | - | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PFB08_RS15160 (2972026) | 2972026..2972736 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PFB08_RS15165 (2972761) | 2972761..2973657 | - | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
PFB08_RS15170 (2973769) | 2973769..2974290 | + | 522 | WP_001055867.1 | flavodoxin FldB | - |
PFB08_RS15175 (2974330) | 2974330..2974737 | - | 408 | WP_000244767.1 | protein YgfX | Toxin |
PFB08_RS15180 (2974718) | 2974718..2974984 | - | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
PFB08_RS15185 (2975227) | 2975227..2976207 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
PFB08_RS15190 (2976403) | 2976403..2977062 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
PFB08_RS15195 (2977226) | 2977226..2977536 | - | 311 | Protein_2961 | N(4)-acetylcytidine aminohydrolase | - |
PFB08_RS15200 (2977581) | 2977581..2979014 | + | 1434 | WP_005051722.1 | 6-phospho-beta-glucosidase BglA | - |
PFB08_RS15205 (2979071) | 2979071..2979814 | - | 744 | WP_000951957.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T278956 WP_000244767.1 NZ_CP123365:c2974737-2974330 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU2 |