Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1581699..1582225 | Replicon | chromosome |
| Accession | NZ_CP123365 | ||
| Organism | Shigella flexneri strain MMGSG_23 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | PFB08_RS08150 | Protein ID | WP_000323025.1 |
| Coordinates | 1581699..1581986 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PFB08_RS08155 | Protein ID | WP_000534858.1 |
| Coordinates | 1581986..1582225 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFB08_RS08100 (1576757) | 1576757..1577092 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
| PFB08_RS08105 (1577373) | 1577373..1577481 | - | 109 | Protein_1586 | DUF3927 family protein | - |
| PFB08_RS08120 (1578402) | 1578402..1579223 | - | 822 | WP_000762882.1 | antitermination protein | - |
| PFB08_RS08125 (1579238) | 1579238..1579594 | - | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PFB08_RS08130 (1579607) | 1579607..1580656 | - | 1050 | WP_001265250.1 | DUF968 domain-containing protein | - |
| PFB08_RS08135 (1580658) | 1580658..1580936 | - | 279 | Protein_1590 | hypothetical protein | - |
| PFB08_RS08140 (1581003) | 1581003..1581254 | - | 252 | WP_000980987.1 | protein Rem | - |
| PFB08_RS08145 (1581472) | 1581472..1581627 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| PFB08_RS08150 (1581699) | 1581699..1581986 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| PFB08_RS08155 (1581986) | 1581986..1582225 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PFB08_RS08160 (1582250) | 1582250..1582555 | + | 306 | WP_071818640.1 | hypothetical protein | - |
| PFB08_RS08170 (1583770) | 1583770..1584789 | + | 1020 | Protein_1597 | MHS family MFS transporter YdfJ | - |
| PFB08_RS08175 (1584878) | 1584878..1586338 | + | 1461 | WP_000527804.1 | mannitol dehydrogenase family protein | - |
| PFB08_RS08180 (1586374) | 1586374..1586577 | - | 204 | WP_000214712.1 | putative selenium delivery protein YdfZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1565668..1584789 | 19121 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T278950 WP_000323025.1 NZ_CP123365:c1581986-1581699 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|