Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 281794..282464 | Replicon | plasmid unnamed |
Accession | NZ_CP123353 | ||
Organism | Agrobacterium pusense strain GV2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QE155_RS24030 | Protein ID | WP_006699040.1 |
Coordinates | 281794..282213 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QE155_RS24035 | Protein ID | WP_280171387.1 |
Coordinates | 282210..282464 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE155_RS24015 | 278058..278312 | + | 255 | WP_280171384.1 | DUF6117 family protein | - |
QE155_RS24020 | 279037..280083 | + | 1047 | WP_280171385.1 | toprim domain-containing protein | - |
QE155_RS24025 | 280413..281354 | + | 942 | WP_280171386.1 | DUF2493 domain-containing protein | - |
QE155_RS24030 | 281794..282213 | - | 420 | WP_006699040.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QE155_RS24035 | 282210..282464 | - | 255 | WP_280171387.1 | plasmid stabilization protein | Antitoxin |
QE155_RS24040 | 282620..282817 | - | 198 | WP_280171388.1 | hypothetical protein | - |
QE155_RS24045 | 282898..283422 | - | 525 | WP_280171389.1 | RES domain-containing protein | - |
QE155_RS24050 | 283419..283904 | - | 486 | WP_280171390.1 | DUF2384 domain-containing protein | - |
QE155_RS24055 | 284309..284632 | + | 324 | WP_006699035.1 | DUF736 family protein | - |
QE155_RS24060 | 284691..285110 | + | 420 | WP_280171391.1 | hypothetical protein | - |
QE155_RS24065 | 285088..285366 | - | 279 | WP_045535232.1 | HU family DNA-binding protein | - |
QE155_RS24070 | 286108..286392 | + | 285 | Protein_271 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..448874 | 448874 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15050.15 Da Isoelectric Point: 4.8728
>T278940 WP_006699040.1 NZ_CP123353:c282213-281794 [Agrobacterium pusense]
MILLDTNVVSETMKPFPSQMVQRWLDEQAAETLHLSSITIAEAMFGIRTMPDGQRKQRLAEALDVWIGLFEGRILPFDLD
AAKHYANLGSSARASGKGFPTPDGYIAAIAASKGFAVATRDASAFHAAGLEVIDPWTAE
MILLDTNVVSETMKPFPSQMVQRWLDEQAAETLHLSSITIAEAMFGIRTMPDGQRKQRLAEALDVWIGLFEGRILPFDLD
AAKHYANLGSSARASGKGFPTPDGYIAAIAASKGFAVATRDASAFHAAGLEVIDPWTAE
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|