Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 124897..125477 Replicon plasmid unnamed
Accession NZ_CP123353
Organism Agrobacterium pusense strain GV2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QE155_RS23260 Protein ID WP_280171609.1
Coordinates 124897..125280 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A5D9CLR1
Locus tag QE155_RS23265 Protein ID WP_006699143.1
Coordinates 125277..125477 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE155_RS23235 121174..121734 + 561 WP_280171606.1 hypothetical protein -
QE155_RS23240 122019..122918 - 900 WP_280171607.1 LysR family transcriptional regulator -
QE155_RS23245 123320..123913 + 594 WP_280171705.1 nitroreductase family protein -
QE155_RS23250 124089..124343 + 255 WP_280171608.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QE155_RS23255 124340..124754 + 415 Protein_108 type II toxin-antitoxin system VapC family toxin -
QE155_RS23260 124897..125280 - 384 WP_280171609.1 type II toxin-antitoxin system VapC family toxin Toxin
QE155_RS23265 125277..125477 - 201 WP_006699143.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QE155_RS23270 125844..126115 + 272 Protein_111 AAA family ATPase -
QE155_RS23275 126126..126992 - 867 WP_280171610.1 LysR family transcriptional regulator -
QE155_RS23280 127091..127708 + 618 WP_280171611.1 glutathione transferase GstA -
QE155_RS23285 127768..128367 - 600 WP_280171612.1 gamma carbonic anhydrase family protein -
QE155_RS23290 128609..128779 - 171 WP_280171613.1 nuclear transport factor 2 family protein -
QE155_RS23295 128807..129907 + 1101 WP_280171614.1 transcriptional regulator FtrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..448874 448874


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14105.31 Da        Isoelectric Point: 6.8439

>T278939 WP_280171609.1 NZ_CP123353:c125280-124897 [Agrobacterium pusense]
VILVDSSIWIDHFRHVEPELVKIIGDDQLLCHPFVVGELALGSLRERDAVLAFLTAQREAVVATHAEVMTVIDRHSIFSM
GIGYTDAHLLTSTLLDRRSSLWTRDKRLAAAARKVGAALYPSPHIPQ

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7168.28 Da        Isoelectric Point: 10.7407

>AT278939 WP_006699143.1 NZ_CP123353:c125477-125277 [Agrobacterium pusense]
MRSTINLDDSLMERAKSLTGTKETAALVRQALETLVRVESGKRLIALGGTMPEAEAAPRRRSEVGK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5D9CLR1

References