Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 739255..739886 | Replicon | chromosome |
Accession | NZ_CP123351 | ||
Organism | Agrobacterium pusense strain GV2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QE155_RS03645 | Protein ID | WP_035207667.1 |
Coordinates | 739488..739886 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QE155_RS03640 | Protein ID | WP_035207666.1 |
Coordinates | 739255..739488 (+) | Length | 78 a.a. |
Genomic Context
Location: 734656..735918 (1263 bp)
Type: Others
Protein ID: WP_004441057.1
Type: Others
Protein ID: WP_004441057.1
Location: 736281..737501 (1221 bp)
Type: Others
Protein ID: WP_004441060.1
Type: Others
Protein ID: WP_004441060.1
Location: 737573..738460 (888 bp)
Type: Others
Protein ID: WP_006700159.1
Type: Others
Protein ID: WP_006700159.1
Location: 738465..739127 (663 bp)
Type: Others
Protein ID: WP_004441063.1
Type: Others
Protein ID: WP_004441063.1
Location: 739255..739488 (234 bp)
Type: Antitoxin
Protein ID: WP_035207666.1
Type: Antitoxin
Protein ID: WP_035207666.1
Location: 739488..739886 (399 bp)
Type: Toxin
Protein ID: WP_035207667.1
Type: Toxin
Protein ID: WP_035207667.1
Location: 739902..740732 (831 bp)
Type: Others
Protein ID: WP_035207668.1
Type: Others
Protein ID: WP_035207668.1
Location: 740732..741754 (1023 bp)
Type: Others
Protein ID: WP_077987860.1
Type: Others
Protein ID: WP_077987860.1
Location: 741781..742728 (948 bp)
Type: Others
Protein ID: WP_006700162.1
Type: Others
Protein ID: WP_006700162.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE155_RS03620 | 734656..735918 | + | 1263 | WP_004441057.1 | beta-ketoacyl-ACP synthase II | - |
QE155_RS03625 | 736281..737501 | + | 1221 | WP_004441060.1 | endolytic transglycosylase MltG | - |
QE155_RS03630 | 737573..738460 | + | 888 | WP_006700159.1 | YicC/YloC family endoribonuclease | - |
QE155_RS03635 | 738465..739127 | + | 663 | WP_004441063.1 | guanylate kinase | - |
QE155_RS03640 | 739255..739488 | + | 234 | WP_035207666.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QE155_RS03645 | 739488..739886 | + | 399 | WP_035207667.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QE155_RS03650 | 739902..740732 | - | 831 | WP_035207668.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
QE155_RS03655 | 740732..741754 | - | 1023 | WP_077987860.1 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | - |
QE155_RS03660 | 741781..742728 | - | 948 | WP_006700162.1 | peptidylprolyl isomerase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14855.11 Da Isoelectric Point: 7.1886
>T278937 WP_035207667.1 NZ_CP123351:739488-739886 [Agrobacterium pusense]
MLRYMLDTNICIYVMKTYPTDLRDKFNSLADELCISSITLGELCYGAEKSARRRENLGAIENFTARLEVLPFADKAASHY
GQIRAELARAGTPCGVHDMQIGGHARSEGLIVVTNNMREFVRMPGLRVENWV
MLRYMLDTNICIYVMKTYPTDLRDKFNSLADELCISSITLGELCYGAEKSARRRENLGAIENFTARLEVLPFADKAASHY
GQIRAELARAGTPCGVHDMQIGGHARSEGLIVVTNNMREFVRMPGLRVENWV
Download Length: 399 bp