Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 739255..739886 | Replicon | chromosome |
Accession | NZ_CP123351 | ||
Organism | Agrobacterium pusense strain GV2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QE155_RS03645 | Protein ID | WP_035207667.1 |
Coordinates | 739488..739886 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QE155_RS03640 | Protein ID | WP_035207666.1 |
Coordinates | 739255..739488 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE155_RS03620 | 734656..735918 | + | 1263 | WP_004441057.1 | beta-ketoacyl-ACP synthase II | - |
QE155_RS03625 | 736281..737501 | + | 1221 | WP_004441060.1 | endolytic transglycosylase MltG | - |
QE155_RS03630 | 737573..738460 | + | 888 | WP_006700159.1 | YicC/YloC family endoribonuclease | - |
QE155_RS03635 | 738465..739127 | + | 663 | WP_004441063.1 | guanylate kinase | - |
QE155_RS03640 | 739255..739488 | + | 234 | WP_035207666.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QE155_RS03645 | 739488..739886 | + | 399 | WP_035207667.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QE155_RS03650 | 739902..740732 | - | 831 | WP_035207668.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
QE155_RS03655 | 740732..741754 | - | 1023 | WP_077987860.1 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | - |
QE155_RS03660 | 741781..742728 | - | 948 | WP_006700162.1 | peptidylprolyl isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14855.11 Da Isoelectric Point: 7.1886
>T278937 WP_035207667.1 NZ_CP123351:739488-739886 [Agrobacterium pusense]
MLRYMLDTNICIYVMKTYPTDLRDKFNSLADELCISSITLGELCYGAEKSARRRENLGAIENFTARLEVLPFADKAASHY
GQIRAELARAGTPCGVHDMQIGGHARSEGLIVVTNNMREFVRMPGLRVENWV
MLRYMLDTNICIYVMKTYPTDLRDKFNSLADELCISSITLGELCYGAEKSARRRENLGAIENFTARLEVLPFADKAASHY
GQIRAELARAGTPCGVHDMQIGGHARSEGLIVVTNNMREFVRMPGLRVENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|