Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
Location | 442109..442653 | Replicon | chromosome |
Accession | NZ_CP123351 | ||
Organism | Agrobacterium pusense strain GV2 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QE155_RS02130 | Protein ID | WP_175477655.1 |
Coordinates | 442363..442653 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QE155_RS02125 | Protein ID | WP_035209434.1 |
Coordinates | 442109..442360 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE155_RS02100 | 437207..437896 | - | 690 | WP_003520496.1 | HAD family hydrolase | - |
QE155_RS02105 | 438111..438791 | + | 681 | WP_006699981.1 | GntR family transcriptional regulator | - |
QE155_RS02110 | 438832..439293 | + | 462 | WP_035209498.1 | DUF1284 domain-containing protein | - |
QE155_RS02115 | 439253..440353 | - | 1101 | WP_035209433.1 | hypothetical protein | - |
QE155_RS02120 | 440590..441735 | + | 1146 | WP_004440405.1 | site-specific DNA-methyltransferase | - |
QE155_RS02125 | 442109..442360 | + | 252 | WP_035209434.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QE155_RS02130 | 442363..442653 | + | 291 | WP_175477655.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QE155_RS02135 | 442685..443296 | - | 612 | WP_022555751.1 | HAD family phosphatase | - |
QE155_RS02140 | 443293..444396 | - | 1104 | WP_035209437.1 | A/G-specific adenine glycosylase | - |
QE155_RS02145 | 444494..445021 | + | 528 | WP_006699987.1 | DUF721 domain-containing protein | - |
QE155_RS02150 | 445150..445830 | + | 681 | WP_035209438.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11225.72 Da Isoelectric Point: 6.6456
>T278936 WP_175477655.1 NZ_CP123351:442363-442653 [Agrobacterium pusense]
MGFRLSLPAEEDAIRIAQEGIDLFGPQQARKYHRELFAIFDLISRNPRIARERNELSPSVRIHPFRAHLVVYRVEADDDV
LIVRVRHGHEDWGNEP
MGFRLSLPAEEDAIRIAQEGIDLFGPQQARKYHRELFAIFDLISRNPRIARERNELSPSVRIHPFRAHLVVYRVEADDDV
LIVRVRHGHEDWGNEP
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|