Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 23334..23856 | Replicon | plasmid unnamed |
| Accession | NZ_CP123283 | ||
| Organism | Salmonella sp. SA14318 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G3CAN5 |
| Locus tag | QEN32_RS22610 | Protein ID | WP_000220560.1 |
| Coordinates | 23334..23615 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | QEN32_RS22615 | Protein ID | WP_000121743.1 |
| Coordinates | 23605..23856 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN32_RS22580 | 18351..18701 | + | 351 | WP_000454193.1 | DUF3330 domain-containing protein | - |
| QEN32_RS22585 | 18877..19092 | + | 216 | Protein_24 | recombinase family protein | - |
| QEN32_RS22590 | 19157..19861 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| QEN32_RS22595 | 19913..20656 | - | 744 | Protein_26 | IS5 family transposase | - |
| QEN32_RS22600 | 22244..22552 | - | 309 | Protein_27 | replication initiation protein | - |
| QEN32_RS22610 | 23334..23615 | - | 282 | WP_000220560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QEN32_RS22615 | 23605..23856 | - | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| QEN32_RS22620 | 25090..25926 | + | 837 | WP_001050931.1 | RepB family plasmid replication initiator protein | - |
| QEN32_RS22625 | 25966..26412 | + | 447 | Protein_32 | hypothetical protein | - |
| QEN32_RS22630 | 26549..26905 | + | 357 | WP_000456533.1 | DNA distortion polypeptide 3 | - |
| QEN32_RS22635 | 26902..27879 | - | 978 | WP_024245156.1 | hypothetical protein | - |
| QEN32_RS22640 | 27904..28185 | - | 282 | WP_001185482.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / blaTEM-1B / sul3 / qnrS1 / aadA2 | - | 1..29276 | 29276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11005.83 Da Isoelectric Point: 10.5938
>T278914 WP_000220560.1 NZ_CP123283:c23615-23334 [Salmonella sp. SA14318]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G3CAN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |