Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4205977..4206758 | Replicon | chromosome |
| Accession | NZ_CP123282 | ||
| Organism | Salmonella sp. SA14318 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | QEN32_RS20100 | Protein ID | WP_079945808.1 |
| Coordinates | 4205977..4206468 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | A0A3V4SIN7 |
| Locus tag | QEN32_RS20105 | Protein ID | WP_001110453.1 |
| Coordinates | 4206465..4206758 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN32_RS20070 (4201642) | 4201642..4202391 | - | 750 | WP_001747728.1 | PTS sugar transporter subunit IIC | - |
| QEN32_RS20075 (4202444) | 4202444..4202926 | - | 483 | WP_000108907.1 | PTS sugar transporter subunit IIB | - |
| QEN32_RS20080 (4202944) | 4202944..4203333 | - | 390 | WP_001639590.1 | mannose/fructose/sorbose PTS transporter subunit IIA | - |
| QEN32_RS20085 (4203601) | 4203601..4204413 | + | 813 | Protein_3924 | IS3 family transposase | - |
| QEN32_RS20090 (4204816) | 4204816..4204892 | + | 77 | Protein_3925 | porin family protein | - |
| QEN32_RS20095 (4204992) | 4204992..4205744 | + | 753 | WP_023181278.1 | non-specific acid phosphatase | - |
| QEN32_RS20100 (4205977) | 4205977..4206468 | - | 492 | WP_079945808.1 | GNAT family N-acetyltransferase | Toxin |
| QEN32_RS20105 (4206465) | 4206465..4206758 | - | 294 | WP_001110453.1 | DUF1778 domain-containing protein | Antitoxin |
| QEN32_RS20110 (4207076) | 4207076..4207297 | + | 222 | WP_265322051.1 | hypothetical protein | - |
| QEN32_RS20115 (4207561) | 4207561..4208436 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
| QEN32_RS20120 (4208433) | 4208433..4208720 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| QEN32_RS20125 (4208713) | 4208713..4208994 | - | 282 | WP_265322079.1 | ATP-binding cassette domain-containing protein | - |
| QEN32_RS20130 (4208915) | 4208915..4209117 | + | 203 | Protein_3933 | hypothetical protein | - |
| QEN32_RS20135 (4209125) | 4209125..4209424 | + | 300 | WP_265322080.1 | Ig-like domain-containing protein | - |
| QEN32_RS20140 (4209804) | 4209804..4210709 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4194579..4209424 | 14845 | |
| - | flank | IS/Tn | - | - | 4204084..4204413 | 329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17635.43 Da Isoelectric Point: 7.7297
>T278911 WP_079945808.1 NZ_CP123282:c4206468-4205977 [Salmonella sp. SA14318]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|