Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4068408..4069051 | Replicon | chromosome |
Accession | NZ_CP123282 | ||
Organism | Salmonella sp. SA14318 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | QEN32_RS19400 | Protein ID | WP_000048134.1 |
Coordinates | 4068635..4069051 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | QEN32_RS19395 | Protein ID | WP_001261294.1 |
Coordinates | 4068408..4068638 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN32_RS19380 (4063457) | 4063457..4065109 | + | 1653 | WP_114051902.1 | alpha,alpha-phosphotrehalase | - |
QEN32_RS19385 (4065518) | 4065518..4067656 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QEN32_RS19390 (4067777) | 4067777..4068241 | + | 465 | WP_265322038.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QEN32_RS19395 (4068408) | 4068408..4068638 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QEN32_RS19400 (4068635) | 4068635..4069051 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEN32_RS19405 (4069112) | 4069112..4071025 | - | 1914 | WP_265322039.1 | BglG family transcription antiterminator | - |
QEN32_RS19410 (4071042) | 4071042..4071782 | - | 741 | WP_064047084.1 | KDGP aldolase family protein | - |
QEN32_RS19415 (4071779) | 4071779..4072897 | - | 1119 | WP_183055924.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
QEN32_RS19420 (4072881) | 4072881..4074014 | - | 1134 | WP_265322040.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T278910 WP_000048134.1 NZ_CP123282:4068635-4069051 [Salmonella sp. SA14318]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |