Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4010770..4011320 | Replicon | chromosome |
| Accession | NZ_CP123282 | ||
| Organism | Salmonella sp. SA14318 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | QEN32_RS19125 | Protein ID | WP_265322031.1 |
| Coordinates | 4010770..4011078 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V7ITQ8 |
| Locus tag | QEN32_RS19130 | Protein ID | WP_000016244.1 |
| Coordinates | 4011081..4011320 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN32_RS19110 (4008254) | 4008254..4008370 | + | 117 | Protein_3734 | transposase | - |
| QEN32_RS19115 (4008596) | 4008596..4009612 | - | 1017 | WP_265322030.1 | IS110 family transposase | - |
| QEN32_RS19120 (4009679) | 4009679..4010646 | + | 968 | Protein_3736 | IS3 family transposase | - |
| QEN32_RS19125 (4010770) | 4010770..4011078 | - | 309 | WP_265322031.1 | CcdB family protein | Toxin |
| QEN32_RS19130 (4011081) | 4011081..4011320 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| QEN32_RS19135 (4011433) | 4011433..4011681 | - | 249 | WP_050068098.1 | ribbon-helix-helix domain-containing protein | - |
| QEN32_RS19140 (4011758) | 4011758..4012591 | - | 834 | WP_197397882.1 | DUF4942 domain-containing protein | - |
| QEN32_RS19145 (4012745) | 4012745..4013467 | - | 723 | WP_080190675.1 | retron system putative HNH endonuclease | - |
| QEN32_RS19150 (4013464) | 4013464..4013673 | - | 210 | WP_139819174.1 | hypothetical protein | - |
| QEN32_RS19155 (4013670) | 4013670..4014873 | - | 1204 | Protein_3743 | AAA family ATPase | - |
| QEN32_RS19160 (4014967) | 4014967..4015335 | - | 369 | WP_076727515.1 | TA system toxin CbtA family protein | - |
| QEN32_RS19165 (4015350) | 4015350..4015544 | - | 195 | WP_265322078.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| QEN32_RS19170 (4015489) | 4015489..4015677 | - | 189 | Protein_3746 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11827.63 Da Isoelectric Point: 6.7228
>T278909 WP_265322031.1 NZ_CP123282:c4011078-4010770 [Salmonella sp. SA14318]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRIVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRIVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|